Clone BO28743 Report

Search the DGRC for BO28743

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:43
Vector:pDNR-Dual
Associated Gene/Transcriptrl-RA
Protein status:BO28743.pep: Imported from assembly
Sequenced Size:604

Clone Sequence Records

BO28743.complete Sequence

604 bp assembled on 2011-09-14

GenBank Submission: KX794379

> BO28743.complete
GAAGTTATCAGTCGACATGGAGGAATTTAATTCGAGCGGATCAGTAGTTA
ATGGTACAGGATCTACGGAAGTTCCTCAATCTAATGCTGAAGTTATAAGG
GGACAAATATTTGAAGTTGGTCCTAGGTATATTAAACTCGCCTATATAGG
TGAAGGAGCTTATGGCATGGTTGTGTCTGCGGATGACACGCTAACAAACC
AAAGAGTTGCAATAAAAAAAATATCGCCCTTTGAACACCAAACTTATTGT
CAAAGGACTCTCAGAGAAATAACCATATTGACCAGATTTAAACATGAAAA
CATTATTGATATTCGAGATATTCTTCGAGTTGATAGCATAGACCAAATGA
GAGATGTTTATATTGTACAGTGTTTGATGGAGACTGATTTGTATAAACTA
CTTAAAACACAGGTAATGGTGCTCCCTGATATTTGGTTAAAATTTATTGA
AAGAATAACTACCATTGATATGTGGTGTATTATCTTGGCCATTACTCCAA
ATACCAAGACTGAGTACAATTGTAGGTTGTCGGACATTTTCAATTATGGA
AGTGATTCGCGTTATGCTTTCATGCGGGCTTTAAAAGCAAGCTTTCTAGA
CCAT

BO28743.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
rl-RA 573 CG12559-PA 1..570 17..586 2850 100 Plus
rl-RI 1131 CG12559-PI 1..396 17..412 1980 100 Plus
rl-RC 1131 CG12559-PC 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
rl-RA 1412 CG12559-RA 307..877 16..586 2855 100 Plus
rl-RI 2072 CG12559-RI 102..498 16..412 1985 100 Plus
rl-RC 1614 CG12559-RC 126..522 16..412 1985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 1080331..1080615 302..586 1425 100 Plus
2R 25286936 2R 1072281..1072441 16..176 805 100 Plus
2R 25286936 2R 1076635..1076761 175..301 635 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:19:33 has no hits.

BO28743.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:23 Download gff for BO28743.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 325..890 17..582 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:02 Download gff for BO28743.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 308..873 17..582 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:16 Download gff for BO28743.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 308..873 17..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:16 Download gff for BO28743.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1080331..1080611 302..582 100   Plus
2R 1076635..1076761 175..301 100 -> Plus
2R 1072282..1072439 17..174 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:02 Download gff for BO28743.complete
Subject Subject Range Query Range Percent Splice Strand
2RHet 207045..207325 302..582 100   Plus
2RHet 203349..203475 175..301 100 -> Plus
2RHet 198996..199153 17..174 100 -> Plus

BO28743.pep Sequence

Translation from 16 to 604

> BO28743.pep
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYG
MVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIR
DILRVDSIDQMRDVYIVQCLMETDLYKLLKTQVMVLPDIWLKFIERITTI
DMWCIILAITPNTKTEYNCRLSDIFNYGSDSRYAFMRALKASFLDH

BO28743.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
rl-PA 190 CG12559-PA 1..190 1..190 980 100 Plus
rl-PI 376 CG12559-PI 1..132 1..132 670 100 Plus
rl-PC 376 CG12559-PC 1..132 1..132 670 100 Plus
rl-PD 376 CG12559-PD 1..132 1..132 670 100 Plus
rl-PE 376 CG12559-PE 1..132 1..132 670 100 Plus