Clone BO28744 Report

Search the DGRC for BO28744

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG3119-RB
Protein status:BO28744.pep: Imported from assembly
Sequenced Size:586

Clone Sequence Records

BO28744.complete Sequence

586 bp assembled on 2011-08-24

GenBank Submission: KX794234

> BO28744.complete
GAAGTTATCAGTCGACATGACGGCCAAGATGAAGCTGCGGTCCCAGCTGC
ATCTGCTCACTGGTTTCATGGCTGGATTCGTGCTGGCCTTCGTGCTCCTC
CTCTACGTCTACGATGTCAGCAGGGTGACGCCCTGCTGGAGCAGCACCTC
CACCATGACCACGGCCACAACGGCCAGGATTGAGGATGGTCCACCACCGC
GCATTCTGTGCATGGTGCTCACCTGTCCGGAGAACGTGCAGAGCCTGGCC
AGAAGTGTCTACGAGACCTGGGGCCAGCGCTGCAGCCGCCTGATCTTCGC
CAGCAGCGAGGACTACGAGCCACTGGGCGTGGTCGGTGTGGTGGAGCCAA
CTGGCGGTGGCTACGAGGATCTGTGGAATAAAACGCGCGAGGGATTCCGA
CACGTTTGGGAGCACTACGCTGGCGACTACGATTGGTTCCTCAAGGCAGA
TGACGATACGTACGTGGTCATGGAGAATCTGCAGCACCTGCTCCGTGGCT
TCGATCCGAATACGCCCGTCTTCTTTGGCTACAAGATGTCGCGATACAAT
GTGCTTCTGCATTTTGAAGCAAGCTTTCTAGACCAT

BO28744.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-RB 555 CG3119-PB 1..552 17..568 2760 100 Plus
CG3119-RA 1068 CG3119-PA 1..537 17..553 2685 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-RB 682 CG3119-RB 46..597 17..568 2760 100 Plus
CG3119-RA 1193 CG3119-RA 46..582 17..553 2685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2837344..2837788 461..17 2225 100 Minus
2L 23513712 2L 2837193..2837286 553..460 470 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:44:25 has no hits.

BO28744.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:37 Download gff for BO28744.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 44..595 17..570 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:24 Download gff for BO28744.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 46..597 17..570 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:01 Download gff for BO28744.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 46..597 17..570 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:01 Download gff for BO28744.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2837346..2837788 17..459 100   Minus
2L 2837193..2837286 460..553 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:24 Download gff for BO28744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2837346..2837788 17..459 100   Minus
arm_2L 2837193..2837286 460..553 100 <- Minus

BO28744.pep Sequence

Translation from 16 to 586

> BO28744.pep
MTAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTA
TTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDY
EPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYV
VMENLQHLLRGFDPNTPVFFGYKMSRYNVLLHFEASFLDH

BO28744.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-PB 184 CG3119-PB 1..184 1..184 997 100 Plus
CG3119-PA 355 CG3119-PA 1..179 1..179 970 100 Plus
C1GalTA-PA 388 CG9520-PA 100..213 62..177 317 47.4 Plus
C1GalTA-PC 388 CG9520-PC 100..213 62..177 317 47.4 Plus
C1GalTA-PB 388 CG9520-PB 100..213 62..177 317 47.4 Plus