Clone BO28745 Report

Search the DGRC for BO28745

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptCG5059-RB
Protein status:BO28745.pep: Imported from assembly
Sequenced Size:613

Clone Sequence Records

BO28745.complete Sequence

613 bp assembled on 2011-08-24

GenBank Submission: KX794370

> BO28745.complete
GAAGTTATCAGTCGACATGATTGGTGTGCCACAATCTTGGATCGAACTCA
GCACAACAGCTGCGATGGCTGGCATCAAGAGCCCCGACAGAATCACTCCG
TTGCCATTCAACAATGGCGAGGAGTACCTGAGACTTCTGCGCGAGGCCCA
GCGCGAGTCGAACCAGTCGAGCCGTGTCGTCTCCTTGGCCAGCTCCCGTC
GTGATACGCCCCGTGATAGCCCCAAGAGTCCACCGAACAGTCCCCAGTCG
GAGCTCTGTCCGGATGATGAGCTCAGAAACGTGTACATCAACTACTGGAC
CAAGGGAGGAGACAAACAGAATGCAGGCAATGAAGATTGGCTGAAGAACT
GGAATCAGCCACCCAGTAGCTGGAACATTGAGGATTCAAGTCGGGATGCC
GGCGACGAGGGCGAGAAAAAGAAGACTAACACAGGCTACTCCATCCGTTT
GAAGCGACTGGGCTCCAACTCGTTGTTCTCCCGCGAAATTCTGTACTCGC
TGCTGGTGACCAACGTCCTGTCCCTGCTGCTGGGAGCTGGATTCGGGCTA
TGGTTGAGCAAGCGTGGCATACTCCTTACCCGTGTGGTCATTGACGCAAG
CTTTCTAGACCAT

BO28745.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-RB 582 CG5059-PB 1..579 17..595 2895 100 Plus
CG5059-RA 606 CG5059-PA 41..603 33..595 2815 100 Plus
CG5059-RE 534 CG5059-PE 1..531 65..595 2655 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-RB 1344 CG5059-RB 28..607 16..595 2900 100 Plus
CG5059-RC 1905 CG5059-RC 605..1169 31..595 2825 100 Plus
CG5059-RE 1543 CG5059-RE 243..806 32..595 2820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20515853..20516136 312..29 1375 98.9 Minus
3L 28110227 3L 20515443..20515626 547..364 920 100 Minus
3L 28110227 3L 20515725..20515788 366..303 320 100 Minus
3L 28110227 3L 20515335..20515384 595..546 250 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:45:27 has no hits.

BO28745.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:38 Download gff for BO28745.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 18..596 17..597 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:01 Download gff for BO28745.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 29..607 17..597 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:30 Download gff for BO28745.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 29..607 17..597 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:30 Download gff for BO28745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20517261..20517276 17..32 100   Minus
3L 20515861..20516132 33..304 100 <- Minus
3L 20515725..20515786 305..366 100 <- Minus
3L 20515444..20515623 367..546 100 <- Minus
3L 20515332..20515383 547..597 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:01 Download gff for BO28745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20510361..20510376 17..32 100   Minus
arm_3L 20508961..20509232 33..304 100 <- Minus
arm_3L 20508825..20508886 305..366 100 <- Minus
arm_3L 20508544..20508723 367..546 100 <- Minus
arm_3L 20508432..20508483 547..597 96 <- Minus

BO28745.pep Sequence

Translation from 16 to 613

> BO28745.pep
MIGVPQSWIELSTTAAMAGIKSPDRITPLPFNNGEEYLRLLREAQRESNQ
SSRVVSLASSRRDTPRDSPKSPPNSPQSELCPDDELRNVYINYWTKGGDK
QNAGNEDWLKNWNQPPSSWNIEDSSRDAGDEGEKKKTNTGYSIRLKRLGS
NSLFSREILYSLLVTNVLSLLLGAGFGLWLSKRGILLTRVVIDASFLDH

BO28745.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-PB 193 CG5059-PB 1..193 1..193 1008 100 Plus
CG5059-PA 201 CG5059-PA 14..201 6..193 979 99.5 Plus
CG5059-PE 177 CG5059-PE 1..177 17..193 927 100 Plus
CG5059-PD 177 CG5059-PD 1..177 17..193 927 100 Plus
CG5059-PC 177 CG5059-PC 1..177 17..193 927 100 Plus