Clone BO28746 Report

Search the DGRC for BO28746

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptDh31-RC
Protein status:BO28746.pep: Imported from assembly
Sequenced Size:385

Clone Sequence Records

BO28746.complete Sequence

385 bp assembled on 2011-08-24

GenBank Submission: KX799469

> BO28746.complete
GAAGTTATCAGTCGACATGACAAACCGATGCGCTTGCTTCGCCTTGGCCT
TCCTCCTCTTCTGCCTCTTGGCCATCTCGAGCATCGAGGCAGCTCCGATG
CCCAGGTACCAATCCAATGGAGGATACGGTGGCGCTGGCTATAACGAACT
GGAGGAGGTGCCCGACGACCTACTCATGGAACTGATGACTCGCTTTGGAC
GCACCATCATACGGGCTCGAAACGATCTGGAGAATTCCAAACGAACCGTG
GACTTTGGCTTGGCCCGGGGATATTCGGGTACCCAGGAGGCGAAACATCG
CATGGGTCTGGCTGCAGCCAACTTTGCCGGAGGACCCGGTCGGAGGCGAC
GATCCGAGACCGATGTCGCAAGCTTTCTAGACCAT

BO28746.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-RC 354 CG13094-PC 1..351 17..367 1755 100 Plus
Dh31-RA 351 CG13094-PA 1..348 17..367 1675 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-RC 1295 CG13094-RC 143..493 17..367 1755 100 Plus
Dh31-RA 1292 CG13094-RA 143..490 17..367 1675 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8492670..8492802 367..235 665 100 Minus
2L 23513712 2L 8492967..8493092 234..109 630 100 Minus
2L 23513712 2L 8493744..8493835 108..17 460 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:42:12 has no hits.

BO28746.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:32 Download gff for BO28746.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 143..493 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:17 Download gff for BO28746.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 143..493 17..369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:09 Download gff for BO28746.complete
Subject Subject Range Query Range Percent Splice Strand
Dh31-RC 143..493 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:09 Download gff for BO28746.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8493744..8493835 17..108 100   Minus
2L 8492967..8493092 109..234 100 <- Minus
2L 8492668..8492802 235..369 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:17 Download gff for BO28746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8493744..8493835 17..108 100   Minus
arm_2L 8492967..8493092 109..234 100 <- Minus
arm_2L 8492668..8492802 235..369 98 <- Minus

BO28746.pep Sequence

Translation from 16 to 385

> BO28746.pep
MTNRCACFALAFLLFCLLAISSIEAAPMPRYQSNGGYGGAGYNELEEVPD
DLLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAA
ANFAGGPGRRRRSETDVASFLDH

BO28746.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dh31-PC 117 CG13094-PC 1..117 1..117 607 100 Plus
Dh31-PA 116 CG13094-PA 1..116 1..117 582 98.3 Plus