Clone BO28748 Report

Search the DGRC for BO28748

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptTsp5D-RA
Protein status:BO28748.pep: Imported from assembly
Sequenced Size:883

Clone Sequence Records

BO28748.complete Sequence

883 bp assembled on 2011-08-24

GenBank Submission: KX797765

> BO28748.complete
GAAGTTATCAGTCGACATGGGCAATGCCGGCTACACTTGCATACGCCGCA
CATTCTGCTGGCTCAACATCATTCTATGGTTATGTAGCTGTGCGTTTTTA
GGAGCGGGACTCTGGTTGCGACTGAGCTACGCGGGATACGCCACTTTGCT
GCCCCAGCACGCAGGTCTGAGTGCGGACACCATCTTCATGGGCATCGGGG
GCACCGGATTTGTGGTCAGCTTCTTTGGCTGCTGCGGCGCCTGGGTGCAA
TCCCGCTGTCTCCTGGTATTGTACTTTATGCTGATTGTAATGCTGTTCAT
GAGCGAGTTCCTGGTTGGCTCCATCGCCTTTCTCTTCCGCGGCGGACTGG
GACGGACTTTGGCCAACGAGCTGCGCTTCGGGATCGAGCGGCATTATAAC
AGCAGCGATCGGGGATCTCTGGTGGCGCCTTCGGTGGCCTCCATTTGGGA
CAGCGTGCAGCAGTCGTTCGAGTGTTGCGGCGTTTCCTCCTACGAGGATT
GGTATGACATTCAGTCGTGGCCAGGCAGGCGCTGGGTGCCAGAGTCCTGC
TGCAGGACCCTCTACGACCAGCGCCAGGTGCTCACCGAAGGATCCGGCGA
CGGAATGATGCGTCCCGACTGCGGCAGATCTGAGAATCCGTCGCTGTGGT
GGGACAAGGGCTGTGCCCACTCGCTGCAGAGCTGGTTCACCGGCCAGCTG
AACGTGGTGGGCGCCGTGGGACTGGGCATCGCCTTTGTCCAGCTGTTCGG
GCTGATCACCTCGATGCTGCTGTTCTGCACGGTGAAGCACAAGCGGGCCT
CGGACACCTACAAGTCATACTCCCCGTCGATTGATCCTCAGACCCGCACC
AGCAGTTGGGAAGATGCAAGCTTTCTAGACCAT

BO28748.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-RC 864 CG4690-PC 1..849 17..865 4245 100 Plus
Tsp5D-RB 852 CG4690-PB 1..849 17..865 4245 100 Plus
Tsp5D-RA 852 CG4690-PA 1..849 17..865 4245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-RC 1827 CG4690-RC 145..993 17..865 4245 100 Plus
Tsp5D-RB 1827 CG4690-RB 145..993 17..865 4245 100 Plus
Tsp5D-RA 1972 CG4690-RA 290..1138 17..865 4245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6069965..6070204 865..626 1200 100 Minus
X 23542271 X 6070521..6070716 466..271 980 100 Minus
X 23542271 X 6070857..6071049 271..79 965 100 Minus
X 23542271 X 6070293..6070454 627..466 810 100 Minus
X 23542271 X 6071805..6071867 79..17 315 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:42:38 has no hits.

BO28748.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:34 Download gff for BO28748.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RB 145..993 17..867 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:32 Download gff for BO28748.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 290..1138 17..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:18 Download gff for BO28748.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp5D-RA 290..1138 17..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:18 Download gff for BO28748.complete
Subject Subject Range Query Range Percent Splice Strand
X 6071805..6071867 17..79 100   Minus
X 6070857..6071048 80..271 100 <- Minus
X 6070521..6070715 272..466 100 <- Minus
X 6070293..6070453 467..627 100 <- Minus
X 6069962..6070202 628..867 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:32 Download gff for BO28748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5965838..5965900 17..79 100   Minus
arm_X 5964890..5965081 80..271 100 <- Minus
arm_X 5964554..5964748 272..466 100 <- Minus
arm_X 5964326..5964486 467..627 100 <- Minus
arm_X 5963995..5964235 628..867 99 <- Minus

BO28748.pep Sequence

Translation from 16 to 883

> BO28748.pep
MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAG
LSADTIFMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLV
GSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQS
FECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRP
DCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSM
LLFCTVKHKRASDTYKSYSPSIDPQTRTSSWEDASFLDH

BO28748.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp5D-PC 287 CG4690-PC 1..287 1..287 1550 99 Plus
Tsp5D-PB 283 CG4690-PB 1..283 1..283 1549 100 Plus
Tsp5D-PA 283 CG4690-PA 1..283 1..283 1549 100 Plus
Tsp74F-PB 236 CG5492-PB 71..232 66..253 235 26.6 Plus
Tsp74F-PA 236 CG5492-PA 71..232 66..253 235 26.6 Plus