Clone BO28753 Report

Search the DGRC for BO28753

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:53
Vector:pDNR-Dual
Associated Gene/Transcriptflower-RC
Protein status:BO28753.pep: Imported from assembly
Sequenced Size:505

Clone Sequence Records

BO28753.complete Sequence

505 bp assembled on 2011-08-24

GenBank Submission: KX795178

> BO28753.complete
GAAGTTATCAGTCGACATGTCGTTTGCGGAAAAGATAACGGGTCTGCTGG
CACGGCCGAATCAACAAGATCCAATTGGACCGGAGCAGCCGTGGTATCTC
AAATATGGAAGTCGATTGCTGGGCATTGTGGCCGCCTTCTTTGCCATTCT
TTTCGGCCTGTGGAATGTGTTCTCCATCATCACGCTCAGCGTATCCTGCC
TGGTGGCTGGCATCCTTCAAATGGTGGCAGGATTTGTGGTGATGCTCTTG
GAGGCTCCCTGCTGTTTCGTCTGCTTTGGGCAGGTGAACGAGATCGCGGA
AAAGGTGGAATCTAAGCCCTTGTACTTCCGTGCCGGGCTCTACATTGCCA
TGGCCATTCCGCCCATTATTCTGTGCTTTGGACTGGCCAGCTTATTCGGC
AGTGGGCTGATCTTTGGCACTGGCGTGGTTTACGGCATGATGGCGTTAGG
CAAGAACAAGCATATATTTTTAGTGAGAAACTATATTGCAAGCTTTCTAG
ACCAT

BO28753.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-RC 474 CG6151-PC 1..471 17..487 2355 100 Plus
fwe-RA 585 CG6151-PA 1..440 17..456 2200 100 Plus
fwe-RB 579 CG6151-PB 1..440 17..456 2200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-RC 2364 CG6151-RC 134..605 16..487 2360 100 Plus
fwe-RA 1342 CG6151-RA 134..574 16..456 2205 100 Plus
fwe-RB 3020 CG6151-RB 134..574 16..456 2205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15813419..15813626 348..141 1040 100 Minus
3L 28110227 3L 15815936..15816057 140..19 610 100 Minus
3L 28110227 3L 15813246..15813353 456..349 540 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:46:48 has no hits.

BO28753.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:41 Download gff for BO28753.complete
Subject Subject Range Query Range Percent Splice Strand
flower-RC 140..610 17..489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:54 Download gff for BO28753.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 135..605 17..489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:54:07 Download gff for BO28753.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 135..605 17..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:54:07 Download gff for BO28753.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15815936..15816058 17..140 99   Minus
3L 15813419..15813626 141..348 100 <- Minus
3L 15813246..15813353 349..456 100 <- Minus
3L 15812208..15812241 457..489 94 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:54 Download gff for BO28753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15809036..15809158 17..140 99   Minus
arm_3L 15806519..15806726 141..348 100 <- Minus
arm_3L 15806346..15806453 349..456 100 <- Minus
arm_3L 15805308..15805341 457..489 94 <- Minus

BO28753.pep Sequence

Translation from 16 to 505

> BO28753.pep
MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWN
VFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESK
PLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKNKHI
FLVRNYIASFLDH

BO28753.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-PC 157 CG6151-PC 1..157 1..157 813 100 Plus
fwe-PB 192 CG6151-PB 1..146 1..146 754 100 Plus
fwe-PA 194 CG6151-PA 1..146 1..146 754 100 Plus