Clone BO28754 Report

Search the DGRC for BO28754

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:54
Vector:pDNR-Dual
Associated Gene/Transcriptdap-RA
Protein status:BO28754.pep: Imported from assembly
Sequenced Size:769

Clone Sequence Records

BO28754.complete Sequence

769 bp assembled on 2011-08-24

GenBank Submission: KX797319

> BO28754.complete
GAAGTTATCAGTCGACATGGTCAGTGCCCGAGTCCTGAATCCTGTGATGA
TCAGTGAGTTCTGCAAGATGAGCAGCAGCCCGGCGGTGAGTCGCAATCTG
GCATGCGGTCGTCAGTTGAATCGCATAAAGCGTGACCTCTTCGGTAGCTC
CAAATCCGCCGAGGGTACAGCCAACAAAACACCCTTTAATTCCGAACTGG
AGCGCCATCAAGAACTGGCCACGCAAAAATGGGGCTTTGACTTCCGCGCC
GGCTGCCCTTTAGCTGAAAAATCACCCTACATTTGGGAGCGCGTCAGCTT
CCAGGAGTCGAGCTTCGCCCCAGAGATGTACACCCTAACACGGGCCGCCC
ACGTACGCCCTTCCGCGGATGCAAGTCCTAGCGACATGGACATTTTGGTC
AACGAGCGCTCAGAACGGGAGAACTTTGGCTCCAATCTGGTCAATTCCTC
GCTAGAGTCGAACACGGATAATGAATCTTGTTACGACTCCCAGGACGAGT
CGCTGGCAATGCGGCTTAGCTCCTCCAGCACGACAAGCACATCCTCCATA
GTCCTGCGCAAGAGACAGCCAAAAATCACAGAATTCATGAAGGAGCGCAA
ACGTCTGGCCCAGGCACCCAAGAAACTATCGCCCGCAAAGCGCATGCGCA
CCAGTTCTCCCAGTTCGTCCGCCACTTCCAGCTCCAGCTCCAGCGGTGGA
TTTGGGTTGGGGGCACACTTTGGGGCGATGTTGAAGCGGCCGCGCCACAA
CGCAAGCTTTCTAGACCAT

BO28754.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
dap-RA 738 CG1772-PA 1..735 17..751 3675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
dap-RA 2530 CG1772-RA 618..1354 15..751 3685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9713163..9713563 181..581 2005 100 Plus
2R 25286936 2R 9714907..9715080 578..751 870 100 Plus
2R 25286936 2R 9712938..9713103 15..180 830 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:47:06 has no hits.

BO28754.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:42 Download gff for BO28754.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 618..1352 17..753 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:06 Download gff for BO28754.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 620..1354 17..753 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:54:17 Download gff for BO28754.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 620..1354 17..753 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:54:17 Download gff for BO28754.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9714911..9715080 582..753 98   Plus
2R 9713163..9713563 181..581 100 -> Plus
2R 9712940..9713103 17..180 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:06 Download gff for BO28754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5602416..5602585 582..753 98   Plus
arm_2R 5600668..5601068 181..581 100 -> Plus
arm_2R 5600445..5600608 17..180 100 -> Plus

BO28754.pep Sequence

Translation from 16 to 769

> BO28754.pep
MVSARVLNPVMISEFCKMSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEG
TANKTPFNSELERHQELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSF
APEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNSSLESNT
DNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQA
PKKLSPAKRMRTSSPSSSATSSSSSSGGFGLGAHFGAMLKRPRHNASFLD
H

BO28754.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
dap-PA 245 CG1772-PA 1..245 1..245 1242 100 Plus