Clone BO28756 Report

Search the DGRC for BO28756

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:56
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)neo38-RB
Protein status:BO28756.pep: Imported from assembly
Sequenced Size:1375

Clone Sequence Records

BO28756.complete Sequence

1375 bp assembled on 2011-08-24

GenBank Submission: KX796591

> BO28756.complete
GAAGTTATCAGTCGACATGATGAACTTCTCCGCGTTCGGCGGCCCCTTCT
CCGGCATCCACCAATTTGCCGCTAAATTCGACGCCCAGACGCCGGGCGCC
TTCGGCACGCCCCCCGCGGCTGCCGCGAATGCAGCAGCCGCAGCGGCAGC
GGCCGGCACCGATAACCATGTGCAGCGATATCAGACCAATGGCAATCACT
TTAATCAGAATGTGCCCAACGTTTCGGCTGCCAACAACATGCAATATGGC
CAGAATATCTCCATACCGTACTCACAGCCGCAGGGTGATCTAAACTTTCT
CAATGCAGCCGCTGCGGCCGATCATAAGGGTAAAATCCATCCAAAAATCG
AACGTGACCGGGAAGAAGTCCTCAACCAGCAGATCCTGCAGAATGTCAAC
CAATCCTGGCAGACGTTGGCAAATACGGCCAACACGGTGGACTACTCGTC
ACACCTGCTCTCCGCCACACTGCCCATCTCCATACAGCACTTCCTCAAGT
ACTCGGAGACGATCAAGAAGGAGTCCACCGGCGATGTCCTGAAGAACGGC
ACCAATTTGGCCAGCCTGGCGCTGGGGGGCGTGGCCCTAACGCCCAGCAA
CAACGGTGCGAATGGCGGCCACCACAACGGACTGGTGGGCATGGACCATG
GCGGTCACATGACCAACATGACGGACGCCAACGGAGCGGCGCTGACGAAC
GGAGCTAGCAACGGAGTGAATGGCAATGCTAACGGCACTGTGACCAATGG
TGGCGCCGGCGCCGTCTCGAGCTCCGGATCTGTGGGCACAACAAACGCCA
GCGGCGGCACAGGCACGGCCAGCGGCAAGAAGACCAAAAAGAAGAAACCA
CCAAAGGAGAAGAAGCCGCGCCCCAAACCGGGAGAAATCCGCGAGACAAA
GGCGCTGGATGGCTCGACGCTCTACTGCTGCCCGGAGTGCCAAATGGCCT
ACCCGGATCGCAGCCTCATCGAGCAGCACGTCATCTCGCACGCCGTTGAG
CGGCGCTTCGTCTGCGACATCTGCAATGCGGCGCTGAAGCGCAAGGACCA
CCTGACCAGGCACAAGCTCTCCCACATACCGGACAGGCCGCATGTGTGCA
ATATCTGCATGAAGTCCTTCAAGCGCAAGGAGCAGCTCACTCTGCACATT
GTCATCCATTCCGGCGAGAAGAAGCATGTTTGCATTGAGTGTGGAAAAGG
TTTCTATCGCAAGGATCACTTGCGCAAGCACACACGATCGCACATCGCCC
GGCGTGTCAAGTCGGAGGTGTCGGCGCAGAACGTTAACGGATCCGCCGGA
GGCGGTGGCGGCGGTGGAGGCGGCAACAGTGCGCAGAGCAACGCGCTGCA
CGGCTCCGCAAGCTTTCTAGACCAT

BO28756.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 1368 CG6930-PL 1..1341 17..1357 6705 100 Plus
l(3)neo38-RK 1344 CG6930-PK 1..1341 17..1357 6705 100 Plus
l(3)neo38-RC 1344 CG6930-PC 1..1341 17..1357 6705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 2247 CG6930-RL 672..2015 14..1357 6720 100 Plus
l(3)neo38-RK 1611 CG6930-RK 36..1379 14..1357 6720 100 Plus
l(3)neo38-RC 2247 CG6930-RC 672..2015 14..1357 6720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11769370..11770105 1102..367 3680 100 Minus
3R 32079331 3R 11777474..11777681 221..14 1040 100 Minus
3R 32079331 3R 11768843..11769002 1357..1198 800 100 Minus
3R 32079331 3R 11771154..11771301 368..221 740 100 Minus
3R 32079331 3R 11769056..11769154 1201..1103 495 100 Minus
3L 28110227 3L 11603938..11604196 1003..1261 470 78.8 Plus
Blast to na_te.dros performed on 2014-11-27 06:47:44 has no hits.

BO28756.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:43 Download gff for BO28756.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 672..2012 17..1359 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:26 Download gff for BO28756.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 675..2015 17..1359 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:54:33 Download gff for BO28756.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 675..2015 17..1359 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:54:33 Download gff for BO28756.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11777474..11777678 17..221 100   Minus
3R 11771154..11771300 222..368 100 <- Minus
3R 11769370..11770103 369..1102 100 <- Minus
3R 11769058..11769154 1103..1199 100 <- Minus
3R 11768840..11769000 1200..1359 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:26 Download gff for BO28756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7603196..7603400 17..221 100   Minus
arm_3R 7596876..7597022 222..368 100 <- Minus
arm_3R 7595092..7595825 369..1102 100 <- Minus
arm_3R 7594780..7594876 1103..1199 100 <- Minus
arm_3R 7594562..7594722 1200..1359 98 <- Minus

BO28756.pep Sequence

Translation from 16 to 1375

> BO28756.pep
MMNFSAFGGPFSGIHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDN
HVQRYQTNGNHFNQNVPNVSAANNMQYGQNISIPYSQPQGDLNFLNAAAA
ADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHLLSA
TLPISIQHFLKYSETIKKESTGDVLKNGTNLASLALGGVALTPSNNGANG
GHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAV
SSSGSVGTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGS
TLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTRHK
LSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKD
HLRKHTRSHIARRVKSEVSAQNVNGSAGGGGGGGGGNSAQSNALHGSASF
LDH

BO28756.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PL 455 CG6930-PL 1..447 1..447 2369 100 Plus
l(3)neo38-PK 447 CG6930-PK 1..447 1..447 2369 100 Plus
l(3)neo38-PC 447 CG6930-PC 1..447 1..447 2369 100 Plus
l(3)neo38-PB 447 CG6930-PB 1..447 1..447 2369 100 Plus
l(3)neo38-PD 434 CG6930-PD 1..434 1..447 2275 97.1 Plus