Clone BO28757 Report

Search the DGRC for BO28757

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:57
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)82Fd-RC
Protein status:BO28757.pep: Imported from assembly
Sequenced Size:835

Clone Sequence Records

BO28757.complete Sequence

835 bp assembled on 2011-08-24

GenBank Submission: KX795122

> BO28757.complete
GAAGTTATCAGTCGACATGTGGTTCGCCATTTCTCTGTTTGCCATCTTGG
CCGTTTGCGGGTTGGCCGGCCGCAGGTGGGGTCGCTACCTCTATCTGCAC
TACGGCCGCCACCTGCTGCCGCGCTCCCTCCTCTCGGCCAAGAACCGCGC
GCCCACGCCCCCTCTCTCGCCCACCAAGGACGACCAGAGCCTGGAGGCTC
TCCTCGACGAGAGCGGCGAAATGCACGAAACGGTGCTGTCAATGAGCACA
GATGAATATCGCAAGACCTCGCTCTTTGCCACCGGTTCCTTCGACCTGGA
CTTCCCCATACCAGACCTGATCGGCAAGACAGAAATCCTTACAGAGGAGC
ATCGCGAGAAGCTCTGTTCACATCTGCCGGCTAGAGCCGAGGGATACTCC
TGGTCCCTGATCTTCAGCACCTCACAACATGGTTTCGCACTGAACTCCCT
GTACCGCAAAATGGCGCGTCTGGAGAGTCCAGTTCTGATTGTCATTGAGG
ATACGGAGCACAACGTATTTGGTGCCCTCACCTCCTGCTCACTGCATGTG
TCGGATCACTTTTACGGCACCGGTGAGTCCCTGCTCTACAAGTTTAACCC
CAGCTTCAAGGTGTTCCATTGGACTGGCGAGAATATGTACTTCATCAAAG
GAAACATGGAGAGCCTTTCGATTGGCGCTGGAGACGGTCGTTTTGGCCTG
TGGCTGGATGGTGATCTGAACCAGGGACGATCGCAACAGTGCAGCACATA
CGGCAATGAGCCTCTGGCGCCACAAGAAGACTTTGTTATCAAAACACTCG
AATGCTGGGCATTTGTTGCAAGCTTTCTAGACCAT

BO28757.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
mtd-RC 804 CG32464-PC 1..801 17..817 4005 100 Plus
mtd-RI 642 CG32464-PI 50..639 228..817 2935 99.8 Plus
mtd-RAA 2616 CG32464-PAA 2028..2613 232..817 2930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
mtd-RC 2303 CG32464-RC 498..1300 15..817 4015 100 Plus
mtd-RI 4838 CG32464-RI 415..1004 228..817 2935 99.8 Plus
mtd-RAA 3789 CG32464-RA 2201..2786 232..817 2930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5282662..5282882 235..15 1105 100 Minus
3R 32079331 3R 5274149..5274318 684..515 850 100 Minus
3R 32079331 3R 5274732..5274895 517..354 820 100 Minus
3R 32079331 3R 5273950..5274082 817..685 665 100 Minus
3R 32079331 3R 5274966..5275088 354..232 615 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:49:31 has no hits.

BO28757.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:44 Download gff for BO28757.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)82Fd-RC 476..1276 17..819 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:55:32 Download gff for BO28757.complete
Subject Subject Range Query Range Percent Splice Strand
mtd-RC 500..1300 17..819 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:55:22 Download gff for BO28757.complete
Subject Subject Range Query Range Percent Splice Strand
mtd-RC 500..1300 17..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:55:22 Download gff for BO28757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5282665..5282880 17..232 100   Minus
3R 5274966..5275087 233..354 100 <- Minus
3R 5274735..5274894 355..514 100 <- Minus
3R 5274149..5274318 515..684 100 <- Minus
3R 5273948..5274082 685..819 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:55:32 Download gff for BO28757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1108387..1108602 17..232 100   Minus
arm_3R 1100688..1100809 233..354 100 <- Minus
arm_3R 1100457..1100616 355..514 100 <- Minus
arm_3R 1099871..1100040 515..684 100 <- Minus
arm_3R 1099670..1099804 685..819 98 <- Minus

BO28757.pep Sequence

Translation from 16 to 835

> BO28757.pep
MWFAISLFAILAVCGLAGRRWGRYLYLHYGRHLLPRSLLSAKNRAPTPPL
SPTKDDQSLEALLDESGEMHETVLSMSTDEYRKTSLFATGSFDLDFPIPD
LIGKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMA
RLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVF
HWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPL
APQEDFVIKTLECWAFVASFLDH

BO28757.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
mtd-PC 267 CG32464-PC 1..267 1..267 1426 100 Plus
mtd-PA 210 CG32464-PA 16..210 73..267 1043 100 Plus
mtd-PI 213 CG32464-PI 19..213 73..267 1043 100 Plus
mtd-PQ 192 CG32464-PQ 1..192 76..267 1031 100 Plus
mtd-PH 192 CG32464-PH 1..192 76..267 1031 100 Plus