Clone BO28759 Report

Search the DGRC for BO28759

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptVps20-RA
Protein status:BO28759.pep: Imported from assembly
Sequenced Size:670

Clone Sequence Records

BO28759.complete Sequence

670 bp assembled on 2011-08-24

GenBank Submission: KX797327

> BO28759.complete
GAAGTTATCAGTCGACATGGGAGCTTTGTTTGGAAAAACCAGCAAAAAGA
CGGCTCCTAGTCGGATCACCGACCAGGACAAGGCGGTTCTGCAATTGAAG
CAACAGAGGGATCGTCTGAAGCAGTACCAAAAACGCATCGAGACGCAGTT
GGAGAATGATCGCCTCCTGGCAAGGAAGTGCCTACAGCAAGGTCGCAAGG
ACCGGGCCAAGCTGCTGCTGCGCAAGAAGAAGTACCAGGAGAGTCTGCTG
ACCAATGCCGACAAACAGCTGGAAAACCTGGAGAAGCTGGCTGCGGACAT
TGAGTTCGCCCAGGTGGAGATGAAGGTGCTGGACGGCCTCAAAGCGGGCA
ATGCTGCTCTGAAGAAGGTGCACGAAATGCTTGACATCGACGAAGTTGAG
CGAATCATGGACGAGACACGCGAGGGCATCGAAAAGCAGCAGGAAATAGA
CGCCATACTGACGGATGTGCTGACCACGCAGGACGAGGAGGACGTTTTGG
CCGAGCTGGATGCCCTGGAGGCGGAGGAAGAGCAGCAGAAGGGTGCACAG
CTGCCGGATGTGCCCACCGAAGATCTGCCCATTCCCGCTGAGATCGAGTC
CGTCGAGGAGCCGGCAAAGACCAAAGCAACCAAGAAAGTCCTGGTGGAGG
CAGCAAGCTTTCTAGACCAT

BO28759.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Vps20-RC 639 CG4071-PC 1..636 17..652 3180 100 Plus
Vps20-RA 639 CG4071-PA 1..636 17..652 3180 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Vps20-RC 899 CG4071-RC 150..786 16..652 3185 100 Plus
Vps20-RA 772 CG4071-RA 23..659 16..652 3185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22608856..22609306 202..652 2255 100 Plus
2R 25286936 2R 22608683..22608793 91..201 555 100 Plus
2R 25286936 2R 22608543..22608618 16..91 380 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:45:42 has no hits.

BO28759.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:39 Download gff for BO28759.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 12..647 17..654 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:13 Download gff for BO28759.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 24..659 17..654 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:37 Download gff for BO28759.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 24..659 17..654 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:37 Download gff for BO28759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22608856..22609306 202..654 99   Plus
2R 22608684..22608793 92..201 100 -> Plus
2R 22608544..22608618 17..91 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:13 Download gff for BO28759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18496361..18496811 202..654 99   Plus
arm_2R 18496189..18496298 92..201 100 -> Plus
arm_2R 18496049..18496123 17..91 100 -> Plus

BO28759.pep Sequence

Translation from 16 to 670

> BO28759.pep
MGALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRL
LARKCLQQGRKDRAKLLLRKKKYQESLLTNADKQLENLEKLAADIEFAQV
EMKVLDGLKAGNAALKKVHEMLDIDEVERIMDETREGIEKQQEIDAILTD
VLTTQDEEDVLAELDALEAEEEQQKGAQLPDVPTEDLPIPAEIESVEEPA
KTKATKKVLVEAASFLDH

BO28759.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Vps20-PC 212 CG4071-PC 1..212 1..212 1040 100 Plus
Vps20-PA 212 CG4071-PA 1..212 1..212 1040 100 Plus
shrb-PA 226 CG8055-PA 5..211 2..211 202 31.8 Plus
CG5498-PB 448 CG5498-PB 239..400 17..180 156 25.9 Plus