Clone BO28760 Report

Search the DGRC for BO28760

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:60
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)05714-RB
Protein status:BO28760.pep: Imported from assembly
Sequenced Size:847

Clone Sequence Records

BO28760.complete Sequence

847 bp assembled on 2011-08-24

GenBank Submission: KX796952

> BO28760.complete
GAAGTTATCAGTCGACATGCTGAAGGGTTACAAGACGGATGAGGACAAGA
AGGTGAAGCGACTGTACCACCAACGCTATCGCACAGAGTGGGAGAAATAT
CCGGAGCTCTCCAGCTGGCTGGCGTCTAGTAATGACGGTTACTCGGCGCA
CTGCAAGATCTGCGACATCAATGTCCTCGCCAGACTAGCGTCCATCAAGC
AGCACCTCGCAACGCGGAAACACCAGGAAAGTTTCAAGTACCACAACATT
CTTGCCAAGAATATGATTAAGGGTGAACTTGTCAAAGATGAGCATGACCC
AGACTTGGAGGCCTCCATAATTTCACCCAAAGCAAAGCCCAAAGCCAAAT
CAAAGACCTATCCAAGGCAAAAGCCAAGGAGCAAAATGCAGCCAAAGATC
AAGAACGACACGAAGGTGGAGAGCATGGAGGAGGAGACGGAGGAGGACGA
AATCGCCTCGAACGACTCAATCCTGGATGATTTACTCAGAACAGATCAGC
CCTATCAAGAGCAAGAATTTGAGGTTGAGAACGAGTTCCTCGAAGTACAA
CAGAATGAAACAGATCTCCAGGACCAAGAGGTGGTCTACGAGGAAGAGAT
GATACAGCTCAAGCCGGAAGATACGGAGATTAATAACGAATACCAAGTCG
ACGCGATGACGGAAGACACCATTATTAGTGAATTTGACTTGTTTGGCAAG
AGTTTGGCTCTGCAGCTGAACAACATGGACCTGGAGGACGCACTAATGTG
CCAGGAGCGTCTGCAGGTGGTCCTAACGGAATTTCGCCTGAAGGTGCTCA
AGCGCAAGAGAGAGCAAGCACGATCTTCGGCAAGCTTTCTAGACCAT

BO28760.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-RB 816 CG8886-PB 1..813 17..829 4065 100 Plus
l(2)05714-RC 783 CG8886-PC 209..780 258..829 2860 100 Plus
l(2)05714-RA 783 CG8886-PA 209..780 258..829 2860 100 Plus
l(2)05714-RC 783 CG8886-PC 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-RB 1082 CG8886-RB 190..1002 17..829 4065 100 Plus
l(2)05714-RC 1089 CG8886-RC 438..1009 258..829 2860 100 Plus
l(2)05714-RA 1049 CG8886-RA 398..969 258..829 2860 100 Plus
l(2)05714-RC 1089 CG8886-RC 230..439 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4970215..4970786 829..258 2860 100 Minus
2L 23513712 2L 4971054..4971296 259..17 1215 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:46:01 has no hits.

BO28760.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:40 Download gff for BO28760.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 158..970 17..831 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:23 Download gff for BO28760.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 158..970 17..831 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:46 Download gff for BO28760.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 190..1002 17..831 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:46 Download gff for BO28760.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4971054..4971296 17..259 100   Minus
2L 4970213..4970784 260..831 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:23 Download gff for BO28760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4971054..4971296 17..259 100   Minus
arm_2L 4970213..4970784 260..831 99 <- Minus

BO28760.pep Sequence

Translation from 16 to 847

> BO28760.pep
MLKGYKTDEDKKVKRLYHQRYRTEWEKYPELSSWLASSNDGYSAHCKICD
INVLARLASIKQHLATRKHQESFKYHNILAKNMIKGELVKDEHDPDLEAS
IISPKAKPKAKSKTYPRQKPRSKMQPKIKNDTKVESMEEETEEDEIASND
SILDDLLRTDQPYQEQEFEVENEFLEVQQNETDLQDQEVVYEEEMIQLKP
EDTEINNEYQVDAMTEDTIISEFDLFGKSLALQLNNMDLEDALMCQERLQ
VVLTEFRLKVLKRKREQARSSASFLDH

BO28760.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-PB 271 CG8886-PB 1..271 1..271 1394 100 Plus
l(2)05714-PC 260 CG8886-PC 1..260 1..271 1314 95.9 Plus
l(2)05714-PA 260 CG8886-PA 1..260 1..271 1314 95.9 Plus