Clone BO28761 Report

Search the DGRC for BO28761

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG12304-RA
Protein status:BO28761.pep: Imported from assembly
Sequenced Size:1036

Clone Sequence Records

BO28761.complete Sequence

1036 bp assembled on 2011-08-24

GenBank Submission: KX799198

> BO28761.complete
GAAGTTATCAGTCGACATGTACGAACTGAAGACTCTGCTGCCGCAATTCG
ACATAAAGCTGCCCACCTGCATGTATCCTCTCAAGAACGTTAGCCTGGCG
GCGGATTCCTTGGCCAGCGGCTCCTCCACATCCGCATCCACATCCGCGTC
CACATCATCATGCAAATTGGAGGCCAACAGGATCGACAGAACGGGACGAA
ACGCAGCCACATGTGCACTTGATTTGGACTCTTTAGGCCGACAAATACAG
CGACTGCTAAAGGACGATACGGCATCAGTGGCCGCCCGACAGGAGAAGGT
TCTCAAGCAGCTGGAGGAGCTGAAGGCGCAGCTGGGACAAATCCGGGCGG
GACTTGGTGTTTGTGGCAAGACTTTCCAGCACACGACTGCTTTCCAGAAT
GGTGGATTAAAGGAGGTGCCACTGCAGGATGTCGTCATCAATGGACATCC
CAACTTCATACCCTATGCCTTGTTGGCCCTGAAAAATGCCTGGCGCAATC
TGTACACTATTGATGTCAAGACCTTTACGCACTCTACGATGGCCGACATT
GGACCAGCAGCACGGGAATTCGAGGCCAACTTGGCGAAGGTTCCAGTAAA
CCCTGCTTTGCCCAAGATTAGTGTGACGCTCATCTGGAAGAACTGCGAAC
ACACCGAGATGATCAGCTCGCCCACCATGTACGTGCCCATCTACGGAGAG
GTGAACATCATTCGCTATCTGGGCCGTGTGGGTCCAGCCGAGTATCGTTA
TGAGGGCTCTCCGCTCTGCAATGAGATCGACCTTGTCCTGGACATTTGCT
ACCAACTGCTGCGCTGCAACACGCACAAAACGCAGGTGGCCATGGTGCGC
CTGCTGGACAAGCGACTGCAGAAGCAGCAGTATTTCGGTGGATCCCAGAT
GTCGGTGGCGGATGTCGGTGTCTACAGCTCACTGATACGCATGCCAGCTG
TTACCGAGAAGGATCTGACGCCTGCGCTAGTGGCTTGGAGAAAAAGGGCC
AAGCTCGTGGTTCAAATTGCAAGCTTTCTAGACCAT

BO28761.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-RA 1005 CG12304-PA 1..1002 17..1018 5010 100 Plus
CG12304-RB 906 CG12304-PB 148..903 263..1018 3780 100 Plus
CG12304-RB 906 CG12304-PB 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-RA 1150 CG12304-RA 98..1099 17..1018 5010 100 Plus
CG12304-RB 1051 CG12304-RB 245..1000 263..1018 3780 100 Plus
CG12304-RB 1051 CG12304-RB 98..244 17..163 735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15584923..15585296 645..1018 1870 100 Plus
3L 28110227 3L 15584638..15584869 414..645 1160 100 Plus
3L 28110227 3L 15584285..15584441 261..417 785 100 Plus
3L 28110227 3L 15583735..15583881 17..163 735 100 Plus
3L 28110227 3L 15583997..15584096 164..263 500 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:50:04 has no hits.

BO28761.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:45 Download gff for BO28761.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 93..1094 17..1020 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:55:50 Download gff for BO28761.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 98..1099 17..1020 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:55:38 Download gff for BO28761.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 98..1099 17..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:55:38 Download gff for BO28761.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15584923..15585296 645..1020 99   Plus
3L 15584640..15584868 416..644 100 -> Plus
3L 15584287..15584439 263..415 100 -> Plus
3L 15583997..15584095 164..262 100 -> Plus
3L 15583735..15583881 17..163 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:55:50 Download gff for BO28761.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15578023..15578396 645..1020 99   Plus
arm_3L 15577740..15577968 416..644 100 -> Plus
arm_3L 15577387..15577539 263..415 100 -> Plus
arm_3L 15577097..15577195 164..262 100 -> Plus
arm_3L 15576835..15576981 17..163 100 -> Plus

BO28761.pep Sequence

Translation from 16 to 1036

> BO28761.pep
MYELKTLLPQFDIKLPTCMYPLKNVSLAADSLASGSSTSASTSASTSSCK
LEANRIDRTGRNAATCALDLDSLGRQIQRLLKDDTASVAARQEKVLKQLE
ELKAQLGQIRAGLGVCGKTFQHTTAFQNGGLKEVPLQDVVINGHPNFIPY
ALLALKNAWRNLYTIDVKTFTHSTMADIGPAAREFEANLAKVPVNPALPK
ISVTLIWKNCEHTEMISSPTMYVPIYGEVNIIRYLGRVGPAEYRYEGSPL
CNEIDLVLDICYQLLRCNTHKTQVAMVRLLDKRLQKQQYFGGSQMSVADV
GVYSSLIRMPAVTEKDLTPALVAWRKRAKLVVQIASFLDH

BO28761.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-PA 334 CG12304-PA 1..334 1..334 1710 100 Plus
CG12304-PB 301 CG12304-PB 1..301 1..334 1503 90.1 Plus