Clone BO28771 Report

Search the DGRC for BO28771

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:71
Vector:pDNR-Dual
Associated Gene/Transcriptmfas-RE
Protein status:BO28771.pep: Imported from assembly
Sequenced Size:2551

Clone Sequence Records

BO28771.complete Sequence

2551 bp assembled on 2011-09-19

GenBank Submission: KX794083

> BO28771.complete
GAAGTTATCAGTCGACATGCTACGGCTGTGGGCCTGCCTGCTCCTCCTGG
GATCAATCCAGATCCAGGCGGTTCCATTCTACGGCGATTCAAGTTCTGAA
GAGGTTGCCGAATTCGATGACTCCTCGGATTCCACACACGAGTCCTCAGA
TAACTCCAGCGGATACGACACCGAGTTCGTGCCACTGGAGCACCAGCAGC
AGCCGCAGGGACGCCAGGAGACGGCGGCCACCGTTCCCGCTCAAACCCCC
AGCGGTGTGGAGCAGAAGCCGTTCAATGTGGACACCATCACCACGGATGT
GAATTCCCCAAATCCGGCCATCTTCTTCCAGCAATCGTTCCCCTTCTTTG
GCAATGAGTTCTTCAATTCGTTCGGAGGCTTTGGCTTTGGAGCTGCCCAG
GAGCCCTGGTGGAAGGGACCCAATGTGTGCACCGAAAAGGAGGAAGACGA
GACTGTGGCCAGTGAAACGGAGGCAGAAGAAACCGTGGACACCTTTGGCC
AGGAACGTGATGGCGTTACCAACGTGGTGCGATCCCCACTCTTTGGCCAG
TTCCAGTTCAGCGTTAACTCCTGCGCCGAGAAGCCCAACAAGCACGTCTG
CACCAAGATCGTGAATCAAAATGGCAAGAAGAAAACGCTGACGCTGACCC
GCCAGTGCTGCTATGGATATGGACGCCCCAGAAACGCTGACTTCACAACG
CCCTGCGAGAAGATCGACATCAAGGACGTGGAGGCCACGGCCAGTGACAT
GGGTGCCAAGCAGTTCCTGGAGAGTGCACGCACCGCCGGTGAGCTGGCCG
ATATGCTCGGAGCAGGCAGTGGCAAGAAGGTGACCCTCTTCGTGCCCAAC
GACGCCGCCTTCATGGAGTACCGTGGTCATCATCAGCAGGAGAATAATGT
GGAAGATGCCAAGGCCGAGGCTTCCAAGCCATCCATCTACAAACTGCACG
CTGTTCTCGGCGAAGTTCAGCTGGAGGATGTGCCCAATGAGAAGCTTCTG
CAGACGGAGCTGCCTGACCAGAAGATCCGCATCAACAGCTACCAGCTGCC
TGCGGCTTTGGGCCTGGAACCCTACCGCTTTGCCGCCAACTGTGTGCCCA
TCGAGAAGCACGACAAGCTCTCGGAGCAGGCCCTTGTCCACACTCTGGGC
GGAGTCCTGAAGCCGCTGACCAAGAACCTTATGGATATCATCAGGGAGCG
TGCGGATATGTCCATTATGCGCACCGTTCTGGAGAAGACCAACCTGAGCG
CCATGCTAGAGGATGACAAGCCAGTGACCATCTTTGTGCCCACCGATGCC
GCCTTCGACAAGTTGGAACCTCATCTGCGTCGAGCCCTCAAGGAAGGTCG
CGGTTGTGCCTCCAACATCCTGAAGAACCATTTGCTGGACCTCACCTTCT
GCTCGCTGGCCACTGTTCCGGGTGCCAAGACGACGGCCTACAATCTACTG
GGAGAACCCCTGCTCCTCAACCGAACCCACCGCGCTGCGAATCAGACTGG
ACCGACTCCCATCTACATCAATAACTTGGCCAAAATCATTGATGCCGATA
TCATGGGCACCAATGGTGTGCTGCACGTAATCGACACCATCCTGCCCACC
GAATCGGCTCTGCCCATGACCTCGCTGATGTCGCAAAAGAACCTGACCAT
CTTCCAGCGATTGCTGGAGGCCTCCGGCTACGATGATCAGTTCGACGATC
TGGACAACGTGACCATCTTTGCACCAACTGACAAGGCTCTGCAGAATACG
GAATGGGCTCGCATGCTCAAGGAACAGCCGGAGCTGCTGAATCATAACTT
GGATCTGCTGGAGTTCCTTAACTACCATGTGGTCAAGCCCATGATCAAGA
CCTGTGACCTGTCGGAGAAGTCCCTGCCCACGGTTGCTGGATCTAGTGTG
CGTCTGAACCTGTACTCCACCCATGCTCTCTTCTCGGACGTGATGAACCG
GGCAACGGTAAACTGTGCCCGTTTGGTGCACTTCGATGACGAGAGCTGCG
GATCCGTTCTCCACCAGGTGGATCGTGCCTTGGCGCCTCCCAAGAATAAC
ATGCTTAAGCTGCTGGAGGCTAATCCCAACTACAGCAAGTTCCTGGAGCT
GGTTCGTAAGGCTAATCTTACACAGCTGCTGTCCAACGATTCGAGGAGTC
TCACCCTGCTGGTGCCAAAGAACGATATCTTCGAGGAGCTGAACGAGTCC
GGTGAGGGTTCAAAGCCCGCCGATCCCATGGCCTTGGTCAAAACCCATAT
CGTTGAGGATGTTGTCTGCTGTGCCGGCATTATCCCAACCAACTGGCCAT
TTGTCCGCTCCATCGAGTCCATCTCTGGCCAGCATCTGCGTATCACCCGC
GATCGTCGTCCCAAGATCGAGAACGCCGGCGTCACCAAGTGCGATGTGGT
GGCCACCAATGGAATTCTCCATGAGATCAACGACATCATCGTGCCACGCC
CACAGCGCCAGCAACAGCAGCGACCCCAGCTGATCCCGCCCGGAGCTGGC
TATCAGCCACAGGGCGATTTCGATGTCTTCTTCGCAAGCTTTCTAGACCA
T

BO28771.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-RO 2520 CG3359-PO 1..2517 17..2533 12585 100 Plus
mfas-RE 2520 CG3359-PE 1..2517 17..2533 12585 100 Plus
mfas-RM 2523 CG3359-PM 1..2520 17..2533 12520 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-RO 2764 CG3359-RO 106..2624 15..2533 12595 100 Plus
mfas-RE 2786 CG3359-RE 128..2646 15..2533 12595 100 Plus
mfas-RM 2789 CG3359-RM 128..2649 15..2533 12530 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11985549..11986231 2047..1365 3415 100 Minus
3R 32079331 3R 11985002..11985487 2533..2048 2430 100 Minus
3R 32079331 3R 11986304..11986772 1364..896 2345 100 Minus
3R 32079331 3R 11986835..11987120 895..610 1430 100 Minus
3R 32079331 3R 11987185..11987377 609..417 965 100 Minus
3R 32079331 3R 11988658..11988799 417..276 710 100 Minus
3R 32079331 3R 11989210..11989328 275..157 595 100 Minus
3R 32079331 3R 11992742..11992814 87..15 365 100 Minus
3R 32079331 3R 11992072..11992143 159..88 360 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:45:48 has no hits.

BO28771.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:10 Download gff for BO28771.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RO 108..2624 17..2535 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:41:24 Download gff for BO28771.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RE 130..2646 17..2535 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:09 Download gff for BO28771.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RE 130..2646 17..2535 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:30:09 Download gff for BO28771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11992742..11992812 17..87 100   Minus
3R 11992072..11992143 88..159 100 <- Minus
3R 11989210..11989325 160..275 100 <- Minus
3R 11988658..11988799 276..417 100 <- Minus
3R 11987185..11987376 418..609 100 <- Minus
3R 11986835..11987120 610..895 100 <- Minus
3R 11986304..11986772 896..1364 100 <- Minus
3R 11985549..11986231 1365..2047 100 <- Minus
3R 11984999..11985487 2048..2535 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:41:24 Download gff for BO28771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7818464..7818534 17..87 100   Minus
arm_3R 7817794..7817865 88..159 100 <- Minus
arm_3R 7814932..7815047 160..275 100 <- Minus
arm_3R 7814380..7814521 276..417 100 <- Minus
arm_3R 7812907..7813098 418..609 100 <- Minus
arm_3R 7812557..7812842 610..895 100 <- Minus
arm_3R 7812026..7812494 896..1364 100 <- Minus
arm_3R 7811271..7811953 1365..2047 100 <- Minus
arm_3R 7810721..7811209 2048..2535 99 <- Minus

BO28771.pep Sequence

Translation from 16 to 2551

> BO28771.pep
MLRLWACLLLLGSIQIQAVPFYGDSSSEEVAEFDDSSDSTHESSDNSSGY
DTEFVPLEHQQQPQGRQETAATVPAQTPSGVEQKPFNVDTITTDVNSPNP
AIFFQQSFPFFGNEFFNSFGGFGFGAAQEPWWKGPNVCTEKEEDETVASE
TEAEETVDTFGQERDGVTNVVRSPLFGQFQFSVNSCAEKPNKHVCTKIVN
QNGKKKTLTLTRQCCYGYGRPRNADFTTPCEKIDIKDVEATASDMGAKQF
LESARTAGELADMLGAGSGKKVTLFVPNDAAFMEYRGHHQQENNVEDAKA
EASKPSIYKLHAVLGEVQLEDVPNEKLLQTELPDQKIRINSYQLPAALGL
EPYRFAANCVPIEKHDKLSEQALVHTLGGVLKPLTKNLMDIIRERADMSI
MRTVLEKTNLSAMLEDDKPVTIFVPTDAAFDKLEPHLRRALKEGRGCASN
ILKNHLLDLTFCSLATVPGAKTTAYNLLGEPLLLNRTHRAANQTGPTPIY
INNLAKIIDADIMGTNGVLHVIDTILPTESALPMTSLMSQKNLTIFQRLL
EASGYDDQFDDLDNVTIFAPTDKALQNTEWARMLKEQPELLNHNLDLLEF
LNYHVVKPMIKTCDLSEKSLPTVAGSSVRLNLYSTHALFSDVMNRATVNC
ARLVHFDDESCGSVLHQVDRALAPPKNNMLKLLEANPNYSKFLELVRKAN
LTQLLSNDSRSLTLLVPKNDIFEELNESGEGSKPADPMALVKTHIVEDVV
CCAGIIPTNWPFVRSIESISGQHLRITRDRRPKIENAGVTKCDVVATNGI
LHEINDIIVPRPQRQQQQRPQLIPPGAGYQPQGDFDVFFASFLDH

BO28771.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-PO 839 CG3359-PO 1..839 1..839 4374 100 Plus
mfas-PE 839 CG3359-PE 1..839 1..839 4374 100 Plus
mfas-PM 840 CG3359-PM 1..840 1..839 4362 99.9 Plus
mfas-PG 840 CG3359-PG 1..840 1..839 4362 99.9 Plus
mfas-PF 840 CG3359-PF 1..840 1..839 4362 99.9 Plus