Clone BO28773 Report

Search the DGRC for BO28773

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG17167-RD
Protein status:BO28773.pep: Imported from assembly
Sequenced Size:1600

Clone Sequence Records

BO28773.complete Sequence

1600 bp assembled on 2011-09-19

GenBank Submission: KX798849

> BO28773.complete
GAAGTTATCAGTCGACATGGTCAAAACTGCCACCTTTTGGCGTTGCCTTT
TCTTTACATTATGTGGAAGCTTTTTGACGGTTACTCAGGCCAAAGCAGCA
ACTAGCAACGCAAGCAGTTTTTTGGAGGTGTCGCTGCGCTATTTTGATGA
GCAGCTTCTGCTGGACATCCTGCCACGCGCTCAGTGTCCTGGCGAGGATG
AAGGATCTCCGATGGACGAGTTCGCCGACCTGTTTACGGTGGATCAACTT
CGCCAGGGATGGGTGGTGCTGCACGTCTTCGCTGCGGTTTACTTCTTTAT
CCTGCTGGCCATCATTTGCAACGACTACTTCCTGCCGACTGTGGAGTGCA
TCTGCGAGGACTTGCACCTTTCGAAGGACGTGGCAGCGGCCACTTTCATG
GCTACCGCCACCTCCATGCCCGAATTCTTTACGAACACGATCAGCACGTT
GATTCTGGAGTCAGATATGGGCCTGGGCACGATTATCGGCTCGTTAATGT
TCAACACATTGGGAGTGGCCGGCCTAGCTGCGCTCGCCATCGATAAGCCG
GTGCAACTGGACTGGTGGCCCATAGCTCGCGACTGCTTTATTTATGTCTT
CAACACGATTATCCTGCTGGTCTTGGCCTGGAGTGGAAGCATTAGTTTCA
CGGAGTCCTGCATCATGATGGGATTCCTCATCCTTTACTACCTTATCACG
TTTAACAACAACAAGTTTATGCCCGCCATCCGGGTGTTTATCGAGGATCG
TATGAACTGCTGCTTCTCCACGCGATATGATCTAACGGAGCCTCCAGAGA
ACAGTGCCAAGGCGCAGCTTCCACTCAAAAAAGATCCTCTGTCCGGCGAT
GGCCTCTTTGTTCTTAATCTTCCCGAAAACACCTCGTCCATGTCTTCCAC
CGCCAACCTCACACGTAACAAGCATCTTAACGACGAGGACGACGTCGCAG
ACGTAGTGCCCGGGAGCATATACGCTTACCCGCGTGACGCATCCGGTTGG
ATGCAATTCTGGTGGATCTTCGTCTTCCCCATTAAGGTCACGCTATCCCT
ATTGATCCCGCACCCGATGAAGTACCGCCGACTGTACCCATTATCTTTTA
TCATGTGCATCTTGTGCATTGGCGGAAACGCCTACCTTATTGTCTGGATG
CTGACTGCCTTTGGTGTGGCCATTCATGTGCCTACCATTGTGATGGGTCT
GACCTTCTTGGCTGCTGGCTCTACCATGCCGGAAGCCGTCTCCAGTCTTA
TTTCCCTTAGAAATGGGGAAAATGGCATTGGAGTTTCTAATTCGTTGGGC
GCTAACTCCTTGGCCATCTTGCTATCCCTTGGAGTGCCTTGGTTCATCAA
GAATTGTATACACTACGGAACTGGGGAGCCCCAGCAGGTTGGCACCCAGG
GCATCGAGTATAACATCCTGATCTTGATCATATCCACTATGGCGCTGTTC
ATAATCCTCAGCTTCAGTGGATATCGGCTTACGAAGCGAGTGGGCGTAGC
CCTCTTCACGGTGTACGGAGTCTTTATTGTTCTACAGATCCTCATCGAGA
TGAATGTATTCTTTCCCAGAGATTGCAGCAGCGCAAGCTTTCTAGACCAT

BO28773.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-RD 1569 CG17167-PD 1..1566 17..1582 7830 100 Plus
CG17167-RC 1566 CG17167-PC 1..1563 17..1582 7750 99.8 Plus
CG17167-RF 1503 CG17167-PF 14..1500 96..1582 7435 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-RD 2506 CG17167-RD 294..1863 13..1582 7835 99.9 Plus
CG17167-RC 2503 CG17167-RC 294..1860 13..1582 7755 99.7 Plus
CG17167-RF 2597 CG17167-RF 89..1575 96..1582 7435 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 23078770..23079109 927..1266 1700 100 Plus
X 23542271 X 23079805..23080122 1265..1582 1590 100 Plus
X 23542271 X 23074762..23075070 239..547 1545 100 Plus
X 23542271 X 23077856..23078089 546..779 1170 100 Plus
X 23542271 X 23078159..23078310 779..930 745 99.3 Plus
X 23542271 X 23073102..23073247 94..239 730 100 Plus
X 23542271 X 23068594..23068676 13..95 400 98.8 Plus
Blast to na_te.dros performed on 2014-11-27 10:48:04 has no hits.

BO28773.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:11 Download gff for BO28773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 296..1861 17..1584 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:41:38 Download gff for BO28773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 298..1863 17..1584 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:09 Download gff for BO28773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 298..1863 17..1584 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:31:09 Download gff for BO28773.complete
Subject Subject Range Query Range Percent Splice Strand
X 23079806..23080122 1266..1584 99   Plus
X 23078770..23079108 927..1265 100 -> Plus
X 23078160..23078306 780..926 100 -> Plus
X 23077858..23078089 548..779 100 -> Plus
X 23074763..23075070 240..547 100 -> Plus
X 23073104..23073247 96..239 100 -> Plus
X 23068598..23068676 17..95 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:41:38 Download gff for BO28773.complete
Subject Subject Range Query Range Percent Splice Strand
XHet 58624..58940 1266..1584 99   Plus
XHet 57588..57926 927..1265 100 -> Plus
XHet 56978..57124 780..926 100 -> Plus
XHet 56676..56907 548..779 100 -> Plus
XHet 53581..53888 240..547 100 -> Plus
XHet 51922..52065 96..239 100 -> Plus
XHet 47416..47494 17..95 100 -> Plus

BO28773.pep Sequence

Translation from 16 to 1600

> BO28773.pep
MVKTATFWRCLFFTLCGSFLTVTQAKAATSNASSFLEVSLRYFDEQLLLD
ILPRAQCPGEDEGSPMDEFADLFTVDQLRQGWVVLHVFAAVYFFILLAII
CNDYFLPTVECICEDLHLSKDVAAATFMATATSMPEFFTNTISTLILESD
MGLGTIIGSLMFNTLGVAGLAALAIDKPVQLDWWPIARDCFIYVFNTIIL
LVLAWSGSISFTESCIMMGFLILYYLITFNNNKFMPAIRVFIEDRMNCCF
STRYDLTEPPENSAKAQLPLKKDPLSGDGLFVLNLPENTSSMSSTANLTR
NKHLNDEDDVADVVPGSIYAYPRDASGWMQFWWIFVFPIKVTLSLLIPHP
MKYRRLYPLSFIMCILCIGGNAYLIVWMLTAFGVAIHVPTIVMGLTFLAA
GSTMPEAVSSLISLRNGENGIGVSNSLGANSLAILLSLGVPWFIKNCIHY
GTGEPQQVGTQGIEYNILILIISTMALFIILSFSGYRLTKRVGVALFTVY
GVFIVLQILIEMNVFFPRDCSSASFLDH

BO28773.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-PD 522 CG17167-PD 1..522 1..522 2718 100 Plus
CG17167-PC 521 CG17167-PC 1..521 1..522 2702 99.8 Plus
CG17167-PF 500 CG17167-PF 2..500 24..522 2577 99.4 Plus
CG17167-PE 409 CG17167-PE 1..303 1..303 1581 100 Plus
zyd-PG 499 CG2893-PG 11..489 66..516 776 35.4 Plus
CG17167-PE 409 CG17167-PE 285..409 404..522 541 88.8 Plus