Clone BO28774 Report

Search the DGRC for BO28774

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptSxl-RC
Protein status:BO28774.pep: Imported from assembly
Sequenced Size:1102

Clone Sequence Records

BO28774.complete Sequence

1102 bp assembled on 2011-08-24

> BO28774.complete
GAAGTTATCAGTCGACATGGATTTCAATTTTGATACTGTGACTCCCTGTT
CGACCATGTCGTCCTACTATAACTTTAAGATGGCGAGTGGTGGGCGTGGA
TTTGGGATGTCCCATTCTCTGCCATCCGGAATGGATACTGAATTTTCATT
TCCAAGTTCATCGTCGCGTCGTGGTTACAATGATTTCCCCGGCTGCGGCG
GCAGCGGCGGAAATGGTGGGAGTGCCAACAATTTAGGGGGCGGCAACATG
TGCCACCTGCCGCCGATGGCCAGCAACAACTCGCTGAATAATCTCTGCGG
ATTGTCGCTGGGCAGCGGTGGTAGTGATGATCTCATGAACGATCCTCGGG
CAAGCAACACCAACCTGATTGTCAACTACTTGCCCCAGGACATGACCGAT
CGCGAGCTGTACGCCCTATTCAGAGCCATTGGACCCATCAACACGTGCAG
AATCATGCGAGACTATAAGACTGGCTACAGTTTTGGTTATGCTTTCGTGG
ACTTCACATCGGAAATGGACTCGCAGCGTGCTATTAAAGTGCTGAATGGC
ATCACAGTGCGCAACAAGCGGCTTAAGGTTTCCTATGCACGTCCCGGCGG
AGAATCGATCAAGGACACCAATCTGTATGTGACCAATCTGCCGCGTACCA
TAACCGACGATCAGCTGGACACGATCTTCGGCAAGTACGGTTCCATTGTG
CAGAAGAACATCTTGCGTGACAAGCTCACAGGTCGTCCTCGTGGTGTGGC
CTTTGTTCGGTACAACAAGCGTGAGGAGGCCCAGGAGGCCATTTCGGCGC
TGAACAACGTAATACCCGAGGGCGGATCACAGCCGCTGTCCGTCCGGTTG
GCTGAGGAGCATGGCAAGGCGAAGGCGGCCCACTTTATGTCGCAGATGGG
CGTGGTTCCAGCAAATGTACCACCGCCGCCACCACAACCGCCAGCACATA
TGGCCGCCGCATTCAACATGATGCACAGAGGTAGATCAATTAAATCACAG
CAACGCTTCCAAAACTCGCATCCCTATTTCGATGCTAAAAAGTTTATCGC
AAGCTTTCTAGACCATTCTGTGTGGGCGCTGCTGAAAGCGGGCGGGAGGG
GT

BO28774.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-RC 1035 CG43770-PC 1..1032 17..1048 5145 99.9 Plus
Sxl-RN 1035 CG43770-PN 1..1032 17..1048 5145 99.9 Plus
Sxl-RR 1029 CG43770-PR 1..965 17..981 4810 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-RC 1515 CG43770-RC 117..1148 17..1048 5145 99.9 Plus
Sxl-RN 2758 CG43770-RN 117..1148 17..1048 5145 99.9 Plus
Sxl-RR 3738 CG43770-RR 117..1081 17..981 4810 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7085619..7085955 469..133 1670 99.7 Minus
X 23542271 X 7084531..7084820 1048..759 1450 100 Minus
X 23542271 X 7085156..7085341 761..576 930 100 Minus
X 23542271 X 7085408..7085519 579..468 560 100 Minus
X 23542271 X 7092697..7092767 87..17 355 100 Minus
X 23542271 X 7087613..7087661 134..86 245 100 Minus
X 23542271 X 1371663..1371769 358..464 205 79.4 Plus
X 23542271 X 1372462..1372598 761..897 205 76.6 Plus
Blast to na_te.dros performed 2014-11-27 07:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 690..729 224..185 110 75 Minus

BO28774.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:15 Download gff for BO28774.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RC 111..1146 17..1052 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:49 Download gff for BO28774.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 117..1152 17..1052 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:18 Download gff for BO28774.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 117..1152 17..1052 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:18 Download gff for BO28774.complete
Subject Subject Range Query Range Percent Splice Strand
X 7092697..7092767 17..87 100   Minus
X 7087614..7087659 88..133 100 <- Minus
X 7085619..7085954 134..469 99 <- Minus
X 7085410..7085517 470..577 100 <- Minus
X 7085158..7085339 578..759 100 <- Minus
X 7084526..7084819 760..1052 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:49 Download gff for BO28774.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6986730..6986800 17..87 100   Minus
arm_X 6981647..6981692 88..133 100 <- Minus
arm_X 6979652..6979987 134..469 99 <- Minus
arm_X 6979443..6979550 470..577 100 <- Minus
arm_X 6979191..6979372 578..759 100 <- Minus
arm_X 6978559..6978852 760..1052 99 <- Minus

BO28774.pep Sequence

Translation from 16 to 1102

> BO28774.pep
MDFNFDTVTPCSTMSSYYNFKMASGGRGFGMSHSLPSGMDTEFSFPSSSS
RRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGS
GGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDY
KTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKD
TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYN
KREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPAN
VPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFIASFLDH
SVWALLKAGGRG

BO28774.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-PC 344 CG43770-PC 1..344 1..344 1823 100 Plus
Sxl-PN 344 CG43770-PN 1..344 1..344 1823 100 Plus
Sxl-PR 342 CG43770-PR 1..324 1..324 1708 99.4 Plus
Sxl-PJ 346 CG43770-PJ 21..346 18..344 1700 99.1 Plus
Sxl-PG 346 CG43770-PG 21..346 18..344 1700 99.1 Plus