Clone BO28777 Report

Search the DGRC for BO28777

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptPk92B-RC
Protein status:BO28777.pep: Imported from assembly
Sequenced Size:4135

Clone Sequence Records

BO28777.complete Sequence

4135 bp assembled on 2011-09-19

GenBank Submission: KX795511

> BO28777.complete
GAAGTTATCAGTCGACATGGAAACAGCGATGGATGTGGTGTGTGTAATGG
ATACGGCGGTGGGCGACCATCTGGAGGACCGCCAGTGTGCGCTGGAGGAG
ATCAAGCAGGCAGTGCAGTCGGCGGGCGCCAACTTTCAGCGGGTTCAGTT
CGAGCGCCTGGACTTCGGCGAGACGAATGTGCTGGAGACGTTTTACAACG
CCGATGTGGCCATTATCGACCTGAGCATTCTCACCCAGCAGCGGCCGCTT
TCCTATCACTACGGCGTTAGGGAGAGCTTCGGGATGAAGGAGAACATCCT
CACCTACAACGACATCGATTCCAAGCAGACGCTCAGTCTCAAGCTCTCGT
GTGCCAACTACCTGTTTCTCAGCTACAAGCGGAATGCGGAGACCAATTCC
TGCCACCTGACCAGCCAGCCCAACAGCGGCAACAACAGCAAGGAACCCAA
TGCCGAAGGACGAGTGCCCACTTTGCAGTGGCGCCTCAAGCGAAAGCTGC
AAGATGTTGAGATCCAGTCGAAAGCCCACATGCGTGAGAAATTTCTGAGT
GACATGCGAACGGCGCGGGACACGTACGCCACCAACGGCGCCAAGCTGCA
GAGTATATTGCACGAGATGCGAAAGCGGCTGGACGATCCGCATGTCCTGT
CTGGCGAAGTGGTACACAGTTTCATGTGCTCGCTGAGGGATGTGCAGGAC
TACGATGCCATGGTGCGACTGGTCAATGACCTGAAGAACATACCCAACAC
CCGGAAGTACGTGGAGACGGGCAACATGAGTTTCCTGTACGCCTTCGCCC
TGAACCGAAGAAATCGAAAGGGAGACCGTGAAAAGGCTCTGGAATCTTCG
CTGAAGGCGCTGGAAAAGAAGGAGAACCACTTTCCGGACATGCTCTGCCT
GTGCGGCCGCATCTACAAGGACATCTTTGTGGAATCCGACTACACGGACG
CCACCAGTTTGGCGCACGCCATCAAGTGGTACCGCCAAAGCTTTGAGGTG
CAGCCGAATGAGTATGCAGGCATCAATCTGGCTACTCTGCTGGTTATCGA
GGGCAAGGAGTTTACCAATACGGAGGAGTTGCAGCACATCGGCATGACCT
TAAACAATTTAATCGGTAAAAAGGGCAGCCTATCCTCGCTGAGTGAGTAT
TGGGATGTGGCCACCTTCTTTGAGATCTCCGTTTTGGCCAACGACTACGC
CAAGGCGATTCAAGCTGCCGAGTGCATGTTCAAGCTAAAGCCACCCAACT
GGTATCTGAAGTCGACCATCGGAAATATCTCTCTTATACATCGATTTCGA
AAGAAGCCCGAGGAACGCCAGCCGCCCATCGAGGAGCAGGTGTTCCAGTT
CTGGATGGACTTCTTTCTGGAGGCCACCAACACCGAGGAGGTTAAGAACA
GCATTCGCTTTCCGATTCTGATCCTCGAGCCTCAGAAGATTTATATGCCC
AGTTATGTGACTATAAACATGGATGCGGATGAGAAGTCCATTCAGATTGT
GAACATCTGTTTGGCTCACGCAAAGAATGCGTGTAAGAAAATCCACGACT
TCCTTTTCGTGGCATCGAAGATCAAGTCCGTCAGCCTTTACAAGAGGGAT
GATCGTTGTGCCTACTTGTACGTCCATCACAACTCAGATGATTTTCAAAT
ATATTTTCCCTCCACTGAACGACGACAAAAGTTCTACGATATGATCCTGG
AGATGACTGCAGATCAGGTGGTGTTTGTCAATCTCAGCAATGATGACGCT
AATATCGAGTACGAGTACGACTACGATGAGCAGAATCGCAAAATGGTGCT
GGGCAAAGGTACTTATGGCACCGTGTACGCCGCCAGGGACAAGCAGACGC
AGGTGCGAATCGCCATTAAGGAGGTGCCGGAAAAGAACTCGCAGGATGTG
CAGCCACTGCACGAGGAGATTAAGTTACACTCTCAGCTGCGACATCGCAA
CATAGTTCGCTATTTGGGATCGTGTTCGGAGAACGGCTTCTTCAAGATCT
TCATGGAGCAGGTGCCGGGAGGATCGCTTTCCGACCTCTTAGAGACCAAA
TGGGGTCCGCTCAAGGACAACGAGTCCACCATGGCCTTCTACTCCAAGCA
GATCCTCGAGGGGCTGAAGTACCTTCACGAGCAGGACATTGTTCATCGCG
ATATAAAGGGTGACAACGTGCTGGTTAACACGTATAGCGGCGTGGTTAAG
ATCTCCGATTTCGGCACCTCCAAGCGGCTGGCCCGCATCAACCCGATGAC
GGAGACCTTTACGGGCACCTTGCAGTACATGGCGCCGGAGGTGATTGACC
AGGGAGTACGCGGCTATGGCCCGGCGGCTGACATCTGGTCCTTTGGATGC
ACAAACGTTGAGATGGCTACGGGCAAACCACCGTTTATCGAGCTGGGTAG
CGCCCATGCGGCCATGTTCAAGGTGGGCTTTTACAAGAAGCATCCGAACA
TACCCGAGGAGCTGTCCGCCAACGCAAAGAACTTTATTTTGCGTTGCTTT
GCCATCAGCGTGATGGACCGACCCTCCGCCTCGCAACTTCTGGAAGATCC
CTTCCTACAAGATAAACCCCGCAAGGTGCGCCCAGCCCTGCCCATCAATA
CTGAGTTCGGACGCAGCATTTCGGTGCCGGCTGATCGGTTTGTGCACAAA
ACCACACCGCCGCTGAGCTACAACACAACCTGCAATACGCCCACAACGCC
GGAATTGGACATAACGCATTCATCCTCGGTGGACATTGACGAGCTGCCCA
GCAACCAGTTTATGCTTGAACGGCGAAATTCCCATGGATTTTTGCTCTCG
CCAGAGATTGAACCTTCCACGCCGTCCTTGCGTACGAGCATTAGTGAGAC
GAGCGAGACTGACGGTTTTTACAGGCTTAAAAAGGATTCGCAGAGGCGGA
CAACGCTTTCCAAGGTGCTGGCACTAGACGAATCCAAGATCTGCGATATT
TGGCTGAAGAAGGTCGACGCTGATCAGAACTCGATTGCGATTAGGAAAAG
CGATTTGGAGGTTCTAATCCGAGGACTGCGGGACTACATTATGAACGAAA
ACGAAAAGCATTTGGAAGCGACTATCAACGAACTGAAACAAAAGCTGAAC
AACGACGCAGTTGCTCTGGACCATCTTCATTTGGCGCTGTACTCCTTTCA
GGACGCCGTGGTCTGCGTACTGCGGTACCATTGCATCAAACCCCATTGGA
TGTTCGCATTGGATAATCTGGTTAAGCGGGCCGTCCAGGCGGCGGTCACT
ATTTTCTCTCCTGAACTGGGCGCCAATCTGGCGGACAAAGACCTGTCTGG
AAATGATGATGAGAGCTTGCGTACAAGTCTAATGCAGAAGGGTTCCACCG
AGAGCCAGGAAAAGCAGAGCCTGGAAAAAGTTCTTCCCACGAGCAACACT
CGCGAAGGTGTGGGATTAACGCCTGCGGAATCGGGCGGGGATGCTCTGTC
CAGTTCGATGGAGTGCGCGCGCATCCTGAGAGACATCCGTGACAATCAGC
AGAAGCTGCAACGCCAGCTCCTTGAGCAGCAGCGGCAGAGCATGAGGGCC
CTGCATAATATCAGTCAGGAGCTGGCTCACATTTACATGGGCGGCAGAAA
GAGATTAAGACGCACAATAAACGGCTTTAACAAAAAGTGCCATAGAATGA
GTACCAGTGTGGGCGGAACGTCCGGAGTCCGTCCGAATATAGCGGGCAAT
CCCCGGAGGCAGCTAAACAAGCATCACTTTGGTCTTCACGAAGTAGACGA
GCAGTTGGAGCAGTGGTTGACCCAGCAGGAAATAGACGAGTTCTCAAAGA
CGCTCATCCTGAATGAAGGTTTTACATTTGACGACTTTATCTATAACATG
GAAAAGCTGGACCTCATGAGGCTGGGTCTGCGCGTTGGCATCGAAGTGCG
TTTGTGGAAACTCATTATACAAGAACGTGTGTGCACCTCGTCCGATTGTG
TGGACAGTCCACCAAGCACTTACCACAAACCCATTGGAGGCAATAGCTCT
TTTGCGCTTATTGACAACAACAATACGCTACCATCACCCACAACCACAAC
TCCCGGAACGCCGGGCATCAAAACGAAAATCAAGAAAAGCGAAAGCGAGT
ACGATTCGTGCAGCGAGGCAAGCTTTCTAGACCAT

BO28777.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-RC 4092 CG4720-PC 1..4089 29..4117 20430 100 Plus
Pk92B-RB 3591 CG4720-PB 1..3588 530..4117 17925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-RC 4596 CG4720-RC 194..4294 17..4117 20490 100 Plus
Pk92B-RB 5168 CG4720-RB 1091..4866 342..4117 18865 100 Plus
Pk92B-RB 5168 CG4720-RB 194..520 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19884196..19885095 2710..3609 4500 100 Plus
3R 32079331 3R 19881484..19882381 523..1420 4490 100 Plus
3R 32079331 3R 19882841..19883645 1758..2562 4010 99.9 Plus
3R 32079331 3R 19882437..19882776 1420..1759 1700 100 Plus
3R 32079331 3R 19885154..19885428 3608..3882 1375 100 Plus
3R 32079331 3R 19885493..19885728 3882..4117 1180 100 Plus
3R 32079331 3R 19880113..19880310 146..343 990 100 Plus
3R 32079331 3R 19880881..19881061 342..522 905 100 Plus
3R 32079331 3R 19883709..19883855 2563..2709 735 100 Plus
3R 32079331 3R 19879912..19880043 17..148 660 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:49:21 has no hits.

BO28777.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:12 Download gff for BO28777.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 194..4294 17..4119 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:00 Download gff for BO28777.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 194..4294 17..4119 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:44 Download gff for BO28777.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 194..4294 17..4119 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:31:44 Download gff for BO28777.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19885494..19885728 3883..4119 99   Plus
3R 19885156..19885428 3610..3882 100 -> Plus
3R 19884196..19885095 2710..3609 100 -> Plus
3R 19883709..19883855 2563..2709 100 -> Plus
3R 19882843..19883645 1760..2562 99 -> Plus
3R 19882438..19882776 1421..1759 100 -> Plus
3R 19881484..19882381 523..1420 100 -> Plus
3R 19880883..19881061 344..522 100 -> Plus
3R 19880116..19880310 149..343 100 -> Plus
3R 19879912..19880043 17..148 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:00 Download gff for BO28777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15711216..15711450 3883..4119 99   Plus
arm_3R 15710878..15711150 3610..3882 100 -> Plus
arm_3R 15709918..15710817 2710..3609 100 -> Plus
arm_3R 15709431..15709577 2563..2709 100 -> Plus
arm_3R 15708565..15709367 1760..2562 99 -> Plus
arm_3R 15708160..15708498 1421..1759 100 -> Plus
arm_3R 15707206..15708103 523..1420 100 -> Plus
arm_3R 15706605..15706783 344..522 100 -> Plus
arm_3R 15705838..15706032 149..343 100 -> Plus
arm_3R 15705634..15705765 17..148 100 -> Plus

BO28777.pep Sequence

Translation from 16 to 4135

> BO28777.pep
METAMDVVCVMDTAVGDHLEDRQCALEEIKQAVQSAGANFQRVQFERLDF
GETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDI
DSKQTLSLKLSCANYLFLSYKRNAETNSCHLTSQPNSGNNSKEPNAEGRV
PTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHE
MRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVE
TGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIY
KDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFT
NTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQA
AECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFF
LEATNTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLA
HAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPST
ERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTY
GTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYL
GSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGL
KYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTG
TLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAM
FKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDK
PRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDIT
HSSSVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDG
FYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVL
IRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVC
VLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANLADKDLSGNDDES
LRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMEC
ARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRLRRT
INGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQW
LTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLI
IQERVCTSSDCVDSPPSTYHKPIGGNSSFALIDNNNTLPSPTTTTPGTPG
IKTKIKKSESEYDSCSEASFLDH

BO28777.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-PC 1363 CG4720-PC 1..1363 5..1367 7096 100 Plus
Pk92B-PB 1196 CG4720-PB 1..1196 172..1367 6231 100 Plus
hppy-PE 934 CG7097-PE 24..284 587..848 387 37.4 Plus
hppy-PB 947 CG7097-PB 24..284 587..848 387 37.4 Plus
hppy-PC 968 CG7097-PC 24..284 587..848 387 37.4 Plus