Clone BO28779 Report

Search the DGRC for BO28779

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptLig4-RA
Protein status:BO28779.pep: Imported from assembly
Sequenced Size:2788

Clone Sequence Records

BO28779.complete Sequence

2788 bp assembled on 2011-09-19

GenBank Submission: KX798553

> BO28779.complete
GAAGTTATCAGTCGACATGAGCGTAGATATAGCCAGCACGATCAAGTTCC
GGGATATTTGCAGCCTGTTCGAGAAGATTAAGGCCACGCAAAAGGTGGCT
AACAAGGAGGAGGTCCTCAAGAGCTACTACGAGTCCTTCTGTCGCCACCG
CGAATCCTTTCGCCGGCAAACCGGATTAAACAACGACCAGCCGGAGGACG
GTGCCAGTAGCTTCTATTCCGTGCTGCGACTGCTGCTTCCGGGTGCGGAC
ACTGGTCGGGATACCTATGGATTGCAGATCACCGCGCTGGGCAGGCTCTA
CATCAGGGTGCTCCAGCTACCCACGGACTCCAGCGATGCCATCAGGCTGC
AGCACCGCAACGGAAACATGTACCGGGACTACGGTGATGTTGTTTATTCC
GTGCTTAAGCCAAGGTGCTTTAATCCGCCCAGCAATTTGAGACTGAAAGA
AATCCATCAGATGCTGGACACCATTGCCAACGAGGACACAGAAGTTAAGC
AGCAGCAACTCATCCGGTTTACGGAGCAGGCCTCGCCTGAGGAACAGAAG
TGGCTAATTCGGTTGCTGCTTAAGAGCCTCGGGCTGGGGATCGGTGAGCA
AAAGATTTTCGGTGTGCTGCACCCCAAGGCGCAGGATATCTACCAGCGCT
GCTCCGATCTGGGACATGTGTGCAATCTGCTGGCAGACCGAACCACCGAC
CTAGACGCCAGCAGCAGCAAGGACAGCAAGGCGGCGGTCAAGTTTGTAAA
CCTGAATTCCGTCATACGGCCATTCCACCAGATACGTCCCATGCTGTGCG
AACGATTCCCCGGTGACATCCAGGAGCTGATGCAGTCGGATGTGCTCTAT
CTGGAGACCAAAATGGATGGCGAACGCTTTCAGCTGCACATCGATCGGGG
TCGTTTCATGTACATTTCCCGCAATGGAGTGGACTACACCAGAAACTTTG
GTCACAGCTACGATCACGGCACCTTAACGCCAAAGCTGAGGGGACTTCTG
CCGCTGGGTCTGGAGTCTATCATACTCGACGGCGAGATGATGGTGTGGGA
TACCAACAAACTGCGCTTTCGGGAAAAAGGCGAGAATACGGACGTGAAGA
GCCTGAAGCCGGAGGGCAGCTGGCAGCCATGTTTCGTGGTGTACGATCTG
CTATATTTTAATGGCCAGAGTCTGCTGGACCATACCTACATTCAGCGGGC
GTACAAATTGCAGAAACTCATAGTTGAACAGTCGGGTGTGCTGCAGTTGA
TGCGTGCACGCAAAATCGGTTCCGTTCAAGAGTTCAACGAGCTGTTCCAG
CAGGCACTCGACTCCCACGCCGAGGGCATTGTGCTAAAGAAGCAGGGATC
AAGATATCAGCCTGGCGTTAGACTGGGCGGTGGGTGGTACAAGGACAAGG
CTGATTACATCAAAGGGCTGATCACCGAGTTCGATGTGCTGATCATCGGG
GCATTCTACAATCGCAAGCGCACCTTTGTGGACTCATTTTTACTGGGCGT
TCTCCAGCCGGCGCCGCCAGGCAGCTCTAATCGTCCCGAAGTCTTCAGTA
TTGGAGTGGTTGCCAACAATACGAAACAGCGCGGAGTGCTAAATCACACA
CTGAAACCACATTGGCATGATGTAGTCAATGAGCCACCGCCATTGTGGTT
TCACTACAAGCCCAAGGAGAGGTCCGGATGCCCCGATCTGTGGATTGAAC
CGCAGAACTCGGTAATTTTGCAGGTGAAAGCTGCTGATCTGGCGCCCAAT
GGAGCATTTTTCACCCGAAAATCGTTGCACTTTCCGCGCACTGAGATGAA
ACGGGATGATAAGACCTGGAGCGAGTGTATGACACTTAAGGAGTTTAACG
ATCTCTGCGGAGGTCCTTTGGCCATCAAGAAGTTAAACAAGCGGCAACTG
CGACTAGAGGATGTGACCACCAAGCGGAAACAGATGCGTATGACGCCCTC
GGAGCGAAGCCGACTGGGATTGGCCGTCTATGAGAAGCGCTATGACGCTA
GCACCTCCGCTAGCACTTCCAAACTTTTCGACGGTCTGAGCTTTTGCATT
CTGAGCGGATCTGCCGGACGACACAGCAAGCATCAGCTGCAGGAGCTGGC
TGTTAAAAACGGTGGCTGCATCGTGGAAAATCCCCTGCCCAATGATCCAA
AGTGTTTTTGCATCGCAGGCGATGAGACGTTTTTAGTTAAGCGGCTCATC
CTTCAACAGCCACGCACCTGTGACATTGTGCGCATGGAGTGGCTACTTAG
GGTCTGTCAGAAGCAGGAGCTTGAACTAAAGCCTAGAGATCTTATTGCGG
CCACTGAACCACTGCAGCAGGATCTGGCTGAATGTTTTGATCGGCACGGT
GATAGCTACACCAAAGACATTGCCAACGTGGAGGAGCTGCAGGATCTGCT
TCAAGGCATTGAGTTGACAGCTGATAATGTGGCTGGCATAACCGCATCTA
ATCTCAATGCTCTGGAGGATCAGCTTCTGGATGGGAAAAAGAATCTGAAC
ATGTTCCGCAACCTTAATGCGTTCTTCTACAGTCCGCATGGTGATGAAGT
GGCTAAGCTTCTGTTTCTTCAAAACGGCGGCCGGATAGTCGACGATTCCG
ATCCGCAACTAAATCTGGGATTTATCTGTATGTCTTCTGACATCGATAAC
GACCACTTCGAGCACTGGCTGCACAATCATTCCAAGTTGACCACTGACAA
GGTCTTAAACTCGGCGTGGATACATCAGTGCCATCGCGAAGGCATCCTAC
TTCCTATGCATTCTTTCGTCGCAAGCTTTCTAGACCAT

BO28779.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-RA 2757 CG12176-PA 1..2754 17..2770 13770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-RA 3040 CG12176-RA 72..2825 17..2770 13770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13664799..13666163 2770..1406 6825 100 Minus
X 23542271 X 13666226..13667138 1405..493 4565 100 Minus
X 23542271 X 13667428..13667740 329..17 1565 100 Minus
X 23542271 X 13667196..13667360 494..330 825 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:50:20 has no hits.

BO28779.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:13 Download gff for BO28779.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 69..2822 17..2772 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:12 Download gff for BO28779.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 72..2825 17..2772 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:06 Download gff for BO28779.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 72..2825 17..2772 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:06 Download gff for BO28779.complete
Subject Subject Range Query Range Percent Splice Strand
X 13667428..13667740 17..329 100   Minus
X 13667196..13667360 330..494 100 <- Minus
X 13666226..13667136 495..1405 100 <- Minus
X 13664797..13666163 1406..2772 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:12 Download gff for BO28779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13561461..13561773 17..329 100   Minus
arm_X 13561229..13561393 330..494 100 <- Minus
arm_X 13560259..13561169 495..1405 100 <- Minus
arm_X 13558830..13560196 1406..2772 99 <- Minus

BO28779.pep Sequence

Translation from 16 to 2788

> BO28779.pep
MSVDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRR
QTGLNNDQPEDGASSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQ
LPTDSSDAIRLQHRNGNMYRDYGDVVYSVLKPRCFNPPSNLRLKEIHQML
DTIANEDTEVKQQQLIRFTEQASPEEQKWLIRLLLKSLGLGIGEQKIFGV
LHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKFVNLNSVI
RPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLHIDRGRFMYI
SRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNKLR
FREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQK
LIVEQSGVLQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPG
VRLGGGWYKDKADYIKGLITEFDVLIIGAFYNRKRTFVDSFLLGVLQPAP
PGSSNRPEVFSIGVVANNTKQRGVLNHTLKPHWHDVVNEPPPLWFHYKPK
ERSGCPDLWIEPQNSVILQVKAADLAPNGAFFTRKSLHFPRTEMKRDDKT
WSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRKQMRMTPSERSRL
GLAVYEKRYDASTSASTSKLFDGLSFCILSGSAGRHSKHQLQELAVKNGG
CIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIVRMEWLLRVCQKQ
ELELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDLLQGIEL
TADNVAGITASNLNALEDQLLDGKKNLNMFRNLNAFFYSPHGDEVAKLLF
LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLTTDKVLNSA
WIHQCHREGILLPMHSFVASFLDH

BO28779.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-PA 918 CG12176-PA 1..918 1..918 4840 100 Plus
DNA-ligI-PA 747 CG5602-PA 224..709 128..599 256 23.4 Plus
lig3-PA 806 CG17227-PA 77..642 70..646 251 23.8 Plus