Clone BO28781 Report

Search the DGRC for BO28781

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG9977-RA
Protein status:BO28781.pep: Imported from assembly
Sequenced Size:1597

Clone Sequence Records

BO28781.complete Sequence

1597 bp assembled on 2011-09-19

GenBank Submission: KX794617

> BO28781.complete
GAAGTTATCAGTCGACATGAACAACCTGGCAGACACTGTGGTAGTTGATC
CTGGATTCGGAGGCGGCGACAAGCAGCAGCAGGCTGGACCGGCGCCGCAG
GATGCCAGCGTGGTGGTTCCTCCGCCGGCCACCAAGCAGTCCTCGGCTCT
GAAGAAGACAAGTCGGTACAGGAGCCGCTCGCTTAGTGCCTCCTCAACGG
ATTCCTTCAGCTCCGCCAGCTACACGGGCAGCAGCGAGGATGGCGACGAC
GTGCCGCCCAGGGAGAAGGTCCAAAAGAACTCCAAAGGCAGCTCCGATTT
CTGTGTAAGGAACATAGGCGCCCAGCATGCATTTGGGCGCAGGGAGATCG
AGATTGCGGAGCAGGAGATGCCGGGCATCATAGCGCTGAAGAAGCGGGCG
GCCGAGGACAAGCCTCTGAAGGATGCCAAGATCGTGGGTTGCACACACAT
CAACGCCCAGACTGCCGTGCTCATCGAGACGCTGGTGGAACTGGGCGCCA
GCGTGCGCTGGGCCGCCTGCAACATCTACTCCACGCAGAACGAAGTGGCT
GCTGCTTTGGCCGAATCCGGAATCCCGATCTTTGCCTGGCGCGGCGAGAC
GGAAGAGGACTTCTGGTGGTGCATAGATCGCTGCGTTAACGCCGAGAACT
GGCAGCCAAACATGATCCTGGACGATGGCGGCGATGCCACGCACTTGATG
CTAAAAAAGTACCCGACCATGTTCAAGTTGGTCAAGGGAATCGTCGAGGA
GAGCGTCACCGGAGTGCACCGTCTCTATCAGCTCTCTAAGGCCGGCAAGC
TGACAGTGCCGGCGATGAATGTCAACGATTCGGTGACAAAGACCAAATTT
GACAACCTCTACAGCTGCAAGGAATCCATCCTGGACAGCCTCAAGCGCTC
CACGGACGTGATGTTCGGTGGCAAGCAGGTCGTGGTCTGTGGCTACGGCG
ATGTGGGCAAGGGATGTGCCCAGGCTCTAAAGGGGCAGGGCTGCATTGTG
TACATCACAGAGATCGATCCCATTTGCGCCCTGCAGGCCAGTATGGATGG
CTTCCGTGTGGTCAAGCTGAACGAGGTGATCCGCAACGTAGACATTGTGG
TGACGGCGACCGGCAACAAGAACGTGGTGGTGCGCGAGCACATGGACAAG
ATGAAGAGTGGCTGCATCGTATGCAACATGGGCCACTCGAACACGGAAAT
CGATGTGAATGGCCTGCGCACACCGGACTTGACCTGGGAGAAGGTGCGCT
CCCAGGTGGATCACATTATCTGGCCGGAGGGCAAGTACATCATTCTTCTG
GCCGAGGGCAGGCTGGTCAATCTGAGCTGCTCCAGCATCCCCTCGTTCGC
CGTGTCTATCACCTCGGCCACCCAGGCCCTGGCCCTGATCGAGCTTTTCA
ATGCCCCGCCCGGACGCTACAAGTCGGATGTCTACTTGCTGCCCAAGAAG
ATGGACGAGTATGTTGCCAGCCTGCACCTGCCCACCTTCGATGCCCATTT
GACGGAGCTGAGCGACGAGCAGGCCAAGTACATGGGACTGAACAAGGCCG
GTCCTTTCAAGCCCAACTACTACCGCTACGCAAGCTTTCTAGACCAT

BO28781.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-RA 1566 CG9977-PA 1..1563 17..1579 7800 99.9 Plus
Ahcy89E-RD 1515 CG8956-PD 228..1470 328..1573 1485 74.8 Plus
Ahcy89E-RC 1479 CG8956-PC 228..1470 328..1573 1485 74.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-RA 3020 CG9977-RA 536..2099 16..1579 7805 99.9 Plus
Ahcy89E-RD 1969 CG8956-RD 574..1816 328..1573 1485 74.8 Plus
Ahcy89E-RC 1780 CG8956-RC 451..1693 328..1573 1485 74.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2769387..2769979 1579..987 2965 100 Minus
3L 28110227 3L 2771268..2771790 538..16 2615 100 Minus
3L 28110227 3L 2770041..2770493 989..537 2250 99.8 Minus
3R 32079331 3R 16979477..16980037 888..328 795 76.1 Minus
3R 32079331 3R 16978780..16979024 1454..1207 230 73.8 Minus
3R 32079331 3R 16978592..16978699 1573..1466 195 78.7 Minus
Blast to na_te.dros performed on 2014-11-27 10:51:29 has no hits.

BO28781.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:14 Download gff for BO28781.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 535..2097 17..1581 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:21 Download gff for BO28781.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 537..2099 17..1581 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:36 Download gff for BO28781.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 537..2099 17..1581 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:36 Download gff for BO28781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2771268..2771789 17..538 100   Minus
3L 2770042..2770491 539..988 99 <- Minus
3L 2769385..2769977 989..1581 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:21 Download gff for BO28781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2771268..2771789 17..538 100   Minus
arm_3L 2770042..2770491 539..988 99 <- Minus
arm_3L 2769385..2769977 989..1581 99 <- Minus

BO28781.pep Sequence

Translation from 16 to 1597

> BO28781.pep
MNNLADTVVVDPGFGGGDKQQQAGPAPQDASVVVPPPATKQSSALKKTSR
YRSRSLSASSTDSFSSASYTGSSEDGDDVPPREKVQKNSKGSSDFCVRNI
GAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTA
VLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFW
WCIDRCVNAENWQPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGV
HRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMF
GGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVK
LNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGL
RTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITS
ATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSD
EQAKYMGLNKAGPFKPNYYRYASFLDH

BO28781.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-PA 521 CG9977-PA 1..521 1..521 2716 100 Plus
Ahcy89E-PC 492 CG8956-PC 18..492 43..521 1976 76.8 Plus
Ahcy89E-PD 504 CG8956-PD 18..496 43..525 1973 76.2 Plus
Ahcy13-PC 432 CG11654-PC 16..432 106..521 1154 53.1 Plus
Ahcy13-PA 432 CG11654-PA 16..432 106..521 1154 53.1 Plus