Clone BO28784 Report

Search the DGRC for BO28784

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptOsi19-RB
Protein status:BO28784.pep: Imported from assembly
Sequenced Size:839

Clone Sequence Records

BO28784.complete Sequence

839 bp assembled on 2011-08-24

> BO28784.complete
GAAGTTATCAGTCGACATGGCCAAGTTGCTCCTTGTGATCGTTGGTGTGG
CGGCCCTAGTGGCAGCGGGACAGGCGGCCGGTGGCTCCACCGAAAAGATG
CAGAGGCTTATCGCCGAGGAGCAAAACAAGTGCGCCAGTGGCCAAGACTC
GATGGCCTGCATCAAAGAGCGGGCCATGCGGTTTGTGGACAACGTGATGA
GCAAAGACAGCTTCCAGGTTTCCAACCTGGAAGTCCGCTCCAATGGAGAG
AAGACCACGCCTATCAACGAAGCTCGTGCCAGCAGTGCCGACGGATTTCT
GGACGCCATTGAGAACTATATCCGTGGACACGACGTGAGCATGGACTTGC
CCTTGGCCGATGCCAAGGTCACCGTCTCGGCCCGCAACCTGGTTAACAAT
CAGCTGAGCCTGAACCTCCAGCTGAACGGCGACGATGGCGATGAGGGCAC
CGATGTCGAAGCCAGGGGCAAGAAACACCGTCTCCGCAAGCTGGCCATGC
CCATCCTGGTGCTCATCCTGCTGAAGGCCATCACAGTGATCCCCATGGCC
ATTGGCATCCTGAAGATCAAGGCCTTCAACGCCCTGGCCCTGGGCTTCTT
CTCCTTCATTGTCTCGGTTGGTTTGGCCATTTTCCAATTGTGCAAAAAGA
TTGCTCATGATCACCATCACACCGCCCACATCACCGCCCATGGTCCTTGG
GACGGCCGCACCTTTAGCTCCGTTCCTGCCCCCGTTGTCGAGCAGCCCCA
GAAGTTGGGGCAAGCCCTGGCTTACCAGGCCTACGCTGCAAGCTTTCTAG
ACCAATTCGTTGTGGCGCGGCGAGGGCGGGCGGAGGGGT

BO28784.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19-RB 774 CG15189-PB 1..771 17..787 3855 100 Plus
Osi19-RA 801 CG15189-PA 1..458 17..474 2275 99.8 Plus
Osi19-RA 801 CG15189-PA 477..798 466..787 1610 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19-RB 1111 CG15189-RB 82..852 17..787 3855 100 Plus
Osi19-RA 1138 CG15189-RA 82..539 17..474 2275 99.8 Plus
Osi19-RA 1138 CG15189-RA 558..879 466..787 1610 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6335920..6336178 216..474 1280 99.6 Plus
3R 32079331 3R 6335443..6335645 17..219 1015 100 Plus
3R 32079331 3R 6336279..6336461 467..649 915 100 Plus
3R 32079331 3R 6336798..6336937 648..787 700 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:18:38 has no hits.

BO28784.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:16 Download gff for BO28784.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 80..850 17..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:38 Download gff for BO28784.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 82..852 17..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:00 Download gff for BO28784.complete
Subject Subject Range Query Range Percent Splice Strand
Osi19-RB 82..852 17..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:00 Download gff for BO28784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6336800..6336937 650..787 100   Plus
3R 6336280..6336461 468..649 100 -> Plus
3R 6335922..6336171 218..467 100 -> Plus
3R 6335443..6335643 17..217 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:38 Download gff for BO28784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2162522..2162659 650..787 100   Plus
arm_3R 2162002..2162183 468..649 100 -> Plus
arm_3R 2161644..2161893 218..467 100 -> Plus
arm_3R 2161165..2161365 17..217 100 -> Plus

BO28784.pep Sequence

Translation from 16 to 838

> BO28784.pep
MAKLLLVIVGVAALVAAGQAAGGSTEKMQRLIAEEQNKCASGQDSMACIK
ERAMRFVDNVMSKDSFQVSNLEVRSNGEKTTPINEARASSADGFLDAIEN
YIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDEGTDVEAR
GKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVS
VGLAIFQLCKKIAHDHHHTAHITAHGPWDGRTFSSVPAPVVEQPQKLGQA
LAYQAYAASFLDQFVVARRGRAEG

BO28784.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Osi19-PB 257 CG15189-PB 1..257 1..257 1288 100 Plus
Osi19-PA 266 CG15189-PA 1..266 1..257 1268 96.6 Plus
Osi7-PA 288 CG1153-PA 29..243 17..225 199 26.5 Plus
Osi18-PA 306 CG1169-PA 8..227 7..225 178 25.2 Plus