Clone BO28785 Report

Search the DGRC for BO28785

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:85
Vector:pDNR-Dual
Associated Gene/Transcriptect-RD
Protein status:BO28785.pep: Imported from assembly
Sequenced Size:874

Clone Sequence Records

BO28785.complete Sequence

874 bp assembled on 2011-08-25

GenBank Submission: KX797167

> BO28785.complete
GAAGTTATCAGTCGACATGAAGTTCGTGATTTTGCTGTGCGTGCTGAGCG
CGTTGCTGCTGCAAATTGAAGCGTCGCCCCTCCAGCGGCTTTCGAGAAGC
GAGCGGGCTGTTTCCCGCCAACAGACGGTCAACAATGAGGTGGCTCCGGC
GGTAGCTCCTGCCAGCGATGATGACGATGATGACGACGATGAGGACGACG
ATGATGAGCCTGATCTAGGAGATCTGATCGATGACGATGATGATGATGAT
GAGGAGGAGGACGATGACGAGGACGAGGAGGATGATACGCCCCAGGGTCA
GGCTGCTCCAGCGGCCACTGCCAGCGATGATGACGAAGAGGAAGACGATG
ATGATGACGATTATCTGGACAGGCTGTTCGATGATATCCTGGGCGATGAT
GAAGATGAGGATGATGATGACGAGACACCCGCTGCCACCGCCCAGCAGAG
CGCTGTGGCCGCCGCTCCCGCCCAAACTCTGGATGAGGTCGCCCCCGCTG
CCGCCTCCTCCGTGAGCGCCGGTATCTCCGATGGTGTTGATCTGCCCGCC
GAGTCCGGAAATGCCGCTGAGGTCCTGGCCGCTGGAAATGCTGCCGATGA
GTCCGTTTCCGCTGCCGTTGCTCCGGCGCAAAACGCTGCCGCCAGCAGCA
GCAACAACGAAGGTATCGCCGGTGACGACGACGAGGAGGCCGACGATGAT
GATGACGATGACGACGATGACATTATCGGCGATGACATCATCGAGGCCCG
CCGTGAAGCACGTGAGTCCAAATCGAAGTCGGAAACGGCGACGAAAGAAA
CCAAGGCCAAGAAATCAACAAGTCCCTCAAAGAAGGCCAAGAAAGAGCTG
AAGCATGCAAGCTTTCTAGACCAT

BO28785.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
ect-RD 843 CG6611-PD 1..840 17..856 4200 100 Plus
ect-RB 1746 CG6611-PB 1..749 17..765 3745 100 Plus
ect-RA 1746 CG6611-PA 1..749 17..765 3745 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
ect-RD 2426 CG6611-RD 189..1030 15..856 4210 100 Plus
ect-RB 2046 CG6611-RB 132..882 15..765 3755 100 Plus
ect-RA 2103 CG6611-RA 189..939 15..765 3755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10195441..10195710 664..395 1350 100 Minus
3L 28110227 3L 10196208..10196435 242..15 1140 100 Minus
3L 28110227 3L 10194802..10194997 856..661 980 100 Minus
3L 28110227 3L 10195819..10195972 395..242 770 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:53:47 has no hits.

BO28785.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:10:19 Download gff for BO28785.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 187..1026 17..858 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:08 Download gff for BO28785.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 191..1030 17..858 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:19 Download gff for BO28785.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 191..1030 17..858 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:19 Download gff for BO28785.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10196208..10196433 17..242 100   Minus
3L 10195819..10195971 243..395 100 <- Minus
3L 10195443..10195709 396..662 100 <- Minus
3L 10194800..10194995 663..858 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:08 Download gff for BO28785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10189308..10189533 17..242 100   Minus
arm_3L 10188919..10189071 243..395 100 <- Minus
arm_3L 10188543..10188809 396..662 100 <- Minus
arm_3L 10187900..10188095 663..858 98 <- Minus

BO28785.pep Sequence

Translation from 16 to 874

> BO28785.pep
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDETPAATAQQSAVAAA
PAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADESVSAA
VAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARE
SKSKSETATKETKAKKSTSPSKKAKKELKHASFLDH

BO28785.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
ect-PD 280 CG6611-PD 1..280 1..280 1407 100 Plus
ect-PB 581 CG6611-PB 1..253 1..253 1263 98.8 Plus
ect-PA 581 CG6611-PA 1..253 1..253 1263 98.8 Plus
ect-PF 589 CG6611-PF 1..261 1..253 1244 95.8 Plus
ect-PE 548 CG6611-PE 1..216 1..216 1084 100 Plus