Clone BO28787 Report

Search the DGRC for BO28787

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:87
Vector:pDNR-Dual
Associated Gene/Transcriptbeat-IIb-RB
Protein status:BO28787.pep: Imported from assembly
Sequenced Size:1162

Clone Sequence Records

BO28787.complete Sequence

1162 bp assembled on 2011-08-24

GenBank Submission: KX796415

> BO28787.complete
GAAGTTATCAGTCGACATGTGGCAGACACTATCAACTTTTAGCACATCAC
TCAGAGCAGCAGCAGCAGCAGTGGCAGCACAACCAGCAGCAACTTGCAAC
TGTAGCTGCAAGCTGGAAAACGCGGAAATGCACAGTCACATGTTGCCATC
AGCAGAGATTGCGACAACGGCAGTGCGTAGGTGTTGCTGTCGCACAAAAA
TCACCCGCAGCAACAGCAGCAACTATAGTTGCAACTACGGCAGCAACGTG
ATCCAGTGGCTACTGCTACTGTGCCTTTTCTGTGATTTTGGCCAGGCCGC
GCTGCGTGACGTAAATCTGCTGGTGGAGCCTCCGGCGGTGCGAAGGGGTC
AGTCTGTGGCCCTGCGGTGCGATTACCAATTGGTGGAGGCGCCCCTGTAT
TCCATTAAGTTTTACCGCGGCCAGATGGAATTCTACCGCTACACACCAGG
CGAGTATCCGCCAACCAAGGTCTTTCAGTTCCCCGGCATCAGAGTGGACG
AGAACGGCTCGAATGCCACCACCGTGCTCATCCGCAACGTTAGCTTCGGC
CTGTCCGGACAATTCAGCTGCGAGGTTACGGCGGATGCCCCGCTCTATTC
CACGGCCACAGCCTTCGCCCAGATGCAAGTTGTGGAATTTCCGGAGAAGC
GACCGCAGCTTTTTACGGAACACTCGCGATACGAACCAGGAGATGTTTTG
CGTGCAAATTGCAGTACTTTGCCATCTCGGCCTCGAGCTGATCTTCGTTT
CACCATCAACAATATTCCCGTCAGCACGGAGGAAACGCAGTACATTCGAA
CGGTTGACAGCCTGATTGCATCCCGGCTCAGTCTGAAGCTGCAGCTGCAG
GCGACTCACTTTGTGGCTGGGCTCAGTGCCCATGGAAATGGGAACGGGAA
TGGTAATGGCAATGGAAATGGCAACGGCAATGGCCTGGCGAACGCACTGC
ACCTGGGTGGCGGCGGCGGAGGCGCTGGAGGCGGAGGACTCATCCTGCGT
TGTACGGCGCAAATTGGCGATCTCTATCAGGAGTACAAGGAAATAGAGCT
GGGCACACCGCAAAAGGATCCGGTGCCGGCCAGAGGTAAGCCTCAAAAGG
ATAACTGCCGACAGCCACGAAGCACTGAAAAGAAAATATTTCCGGCAAGC
TTTCTAGACCAT

BO28787.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-RC 1215 CG4135-PC 1..1069 17..1085 5345 100 Plus
beat-IIb-RA 1224 CG4135-PA 1..1078 17..1085 5205 99.1 Plus
beat-IIa-RB 1296 CG14334-PB 232..614 332..714 415 73.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-RC 2442 CG4135-RC 721..1789 17..1085 5345 100 Plus
beat-IIb-RA 2070 CG4135-RA 340..1417 17..1085 5205 99.1 Plus
beat-IIa-RB 2829 CG14334-RB 983..1365 332..714 415 73.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17233173..17233547 1144..770 1875 100 Minus
3R 32079331 3R 17247271..17247538 284..17 1340 100 Minus
3R 32079331 3R 17239692..17239908 500..284 1085 100 Minus
3R 32079331 3R 17238911..17239047 771..635 685 100 Minus
3R 32079331 3R 17239478..17239613 635..500 680 100 Minus
3R 32079331 3R 17321211..17321296 1090..1005 280 88.4 Minus
3R 32079331 3R 17332505..17332662 489..332 220 75.9 Minus
Blast to na_te.dros performed 2014-11-27 07:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6708..6938 29..266 201 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2567 45..276 185 56.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2272..2421 103..247 171 60.3 Plus
roo 9092 roo DM_ROO 9092bp 1041..1151 126..238 163 62.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6832 134..258 142 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2635..2880 41..275 141 58.1 Plus
roo 9092 roo DM_ROO 9092bp 1101..1148 200..247 141 77.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2367 192..247 136 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1096..1136 207..247 133 80.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6767 193..247 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6829 147..246 131 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6788..6842 193..247 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2604..2826 27..247 128 53.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6788 200..247 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6809 200..247 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6776 192..247 120 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..6797 193..247 115 70.9 Plus

BO28787.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:17 Download gff for BO28787.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RB 339..1466 17..1146 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:58 Download gff for BO28787.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 721..1789 17..1085 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:15 Download gff for BO28787.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 721..1789 17..1085 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:15 Download gff for BO28787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17247271..17247538 17..284 100   Minus
3R 17239693..17239907 285..499 100 <- Minus
3R 17239478..17239613 500..635 100 <- Minus
3R 17238913..17239046 636..769 100 <- Minus
3R 17233171..17233547 770..1146 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:58 Download gff for BO28787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13072993..13073260 17..284 100   Minus
arm_3R 13065415..13065629 285..499 100 <- Minus
arm_3R 13065200..13065335 500..635 100 <- Minus
arm_3R 13064635..13064768 636..769 100 <- Minus
arm_3R 13058893..13059269 770..1146 99 <- Minus

BO28787.pep Sequence

Translation from 16 to 1162

> BO28787.pep
MWQTLSTFSTSLRAAAAAVAAQPAATCNCSCKLENAEMHSHMLPSAEIAT
TAVRRCCCRTKITRSNSSNYSCNYGSNVIQWLLLLCLFCDFGQAALRDVN
LLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEYPPT
KVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAF
AQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNI
PVSTEETQYIRTVDSLIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNG
NGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQEYKEIELGTPQK
DPVPARGKPQKDNCRQPRSTEKKIFPASFLDH

BO28787.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-PC 404 CG4135-PC 1..356 1..356 1875 100 Plus
beat-IIb-PA 407 CG4135-PA 1..359 1..356 1861 99.2 Plus
beat-IIa-PB 431 CG14334-PB 56..319 84..356 901 65.7 Plus
beat-IIa-PA 431 CG14334-PA 56..319 84..356 901 65.7 Plus
beat-Ia-PA 427 CG4846-PA 25..261 94..367 398 36.1 Plus