Clone BO28788 Report

Search the DGRC for BO28788

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG17683-RC
Protein status:BO28788.pep: Imported from assembly
Sequenced Size:1453

Clone Sequence Records

BO28788.complete Sequence

1453 bp assembled on 2011-08-24

GenBank Submission: KX799957

> BO28788.complete
GAAGTTATCAGTCGACATGTCGAGGTTGAGCAGAGCGCTGCAGCTTACAG
ATATAGATGATTTTATTACGCCCTCACAGCCCGTGCAAATAGATAAGGCA
AGGTCAAAGACTGGGGCAAAGATAAAGATAAAAGGTGACGGCTGCTTTGA
GGAATCAGAGAGTGGAAATCTAAAACTTAATAAAGTTGATATTTCTCTGC
AAGACTGTCTTGCGTGTTCTGGTTGCATCACTTCAGCTGAAGAAGTCCTT
ATCACGCAGCAGAGCCGAGAAGAGTTGCTTAAGGTCCTTCAAGAGAATTC
AAAGAATAAGGCCTCTGAAGACTGGGATAACGTGCGTACGATCGTGTTCA
CCCTTGCCACCCAGCCTATACTAAGCTTAGCCTATCGCTATCAGATAGGT
GTGGAGGATGCTGCCCGTCATCTTAATGGGTATTTTCGCAGTTTGGGTGC
CGACTATGTTTTGTCCACTAAGGTGGCGGACGATATTGCGCTGCTCGAAT
GTCGTCAAGAATTTGTAGATAGGTACCGCGAAAATGAGAACTTGACCATG
CTTAGCTCCTCTTGTCCGGGGTGGGTTTGTTACGCGGAGAAAACACACGG
AAACTTCTTATTGCCTTACGTTTCCACGACCCGATCTCCTCAGCAAATAA
TGGGAGTGCTTGTGAAGCAAATCCTTGCCGATAAGATGAATGTTCCTGCG
TCACGAATCTACCATGTGACCGTGATGCCTTGCTACGACAAGAAGCTTGA
GGCCTCTCGAGAGGACTTTTTCAGCAAGGCAAATAACTCACGCGACGTAG
ACTGTGTAATCACTTCAGTTGAGGTGGAACAGTTGCTTAGTGAGGCTCAG
CAGCCGCTGTCGCAGTACGATCTCCTTGATTTAGACTGGCCATGGTCTAA
TGTACGCCCAGAATTCATGGTATGGGCTCACGAGAAGACGCTATCTGGCG
GTTACGCAGAACACATATTTAAGTACGCCGCAAAACATATTTTCAACGAA
GATTTAAAAACAGAGTTGGAATTCAAACAGCTCAAAAACCGCGACTTTAG
AGAAATTATACTTAAACAGAATGGCAAAACTGTCCTGAAATTTGCAATTG
CTAACGGTTTCCGGAACATACAAAACTTGGTACAAAAACTGAAGCGTGAA
AAGGTATCAAATTACCACTTTGTTGAGGTAATGGCCTGTCCCTCGGGCTG
TATAAACGGAGGAGCACAAATACGTCCCACTACCGGACAGCACGTTCGCG
AGCTTACCCGGAAACTGGAGGAATTATACCAGAATCTTCCACGGTCCGAA
CCCGAAAACTCCTTAACAAAACATATTTACAATGACTTTTTAGACGGCTT
TCAAAGTGATAAATCATATGACGTGCTGCACACCCGTTACCATGATGTAG
TATCTGAGCTCAGTATATCGCTTAATATAAATTGGGCAAGCTTTCTAGAC
CAT

BO28788.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-RC 1422 CG17683-PC 1..1419 17..1435 7095 100 Plus
CG17683-RA 1434 CG17683-PA 1..1431 17..1435 6940 99.2 Plus
CG17683-RD 1293 CG17683-PD 14..1290 159..1435 6385 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-RC 1785 CG17683-RC 88..1507 16..1435 7100 100 Plus
CG17683-RA 1696 CG17683-RA 88..1519 16..1435 6945 99.2 Plus
CG17683-RD 2403 CG17683-RD 296..1572 159..1435 6385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4131320..4131979 159..818 3300 100 Plus
2R 25286936 2R 4132034..4132653 816..1435 3100 100 Plus
2R 25286936 2R 4131186..4131268 78..160 415 100 Plus
2R 25286936 2R 4131061..4131124 16..79 320 100 Plus
Blast to na_te.dros performed 2014-11-27 07:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 2352..2448 238..143 122 59.8 Minus

BO28788.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:18 Download gff for BO28788.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RE 196..1551 80..1437 99   Plus
CG17683-RE 70..132 17..79 100 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:13 Download gff for BO28788.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 89..1507 17..1437 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:23 Download gff for BO28788.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 89..1507 17..1437 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:23 Download gff for BO28788.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4132037..4132653 819..1437 99   Plus
2R 4131322..4131979 161..818 100 -> Plus
2R 4131188..4131268 80..160 100 -> Plus
2R 4131062..4131124 17..79 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:13 Download gff for BO28788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19542..20158 819..1437 99   Plus
arm_2R 18827..19484 161..818 100 -> Plus
arm_2R 18693..18773 80..160 100 -> Plus
arm_2R 18567..18629 17..79 100 -> Plus

BO28788.pep Sequence

Translation from 16 to 1453

> BO28788.pep
MSRLSRALQLTDIDDFITPSQPVQIDKARSKTGAKIKIKGDGCFEESESG
NLKLNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKAS
EDWDNVRTIVFTLATQPILSLAYRYQIGVEDAARHLNGYFRSLGADYVLS
TKVADDIALLECRQEFVDRYRENENLTMLSSSCPGWVCYAEKTHGNFLLP
YVSTTRSPQQIMGVLVKQILADKMNVPASRIYHVTVMPCYDKKLEASRED
FFSKANNSRDVDCVITSVEVEQLLSEAQQPLSQYDLLDLDWPWSNVRPEF
MVWAHEKTLSGGYAEHIFKYAAKHIFNEDLKTELEFKQLKNRDFREIILK
QNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGA
QIRPTTGQHVRELTRKLEELYQNLPRSEPENSLTKHIYNDFLDGFQSDKS
YDVLHTRYHDVVSELSISLNINWASFLDH

BO28788.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-PC 473 CG17683-PC 1..473 1..473 2462 100 Plus
CG17683-PA 477 CG17683-PA 1..477 1..473 2447 99.2 Plus
CG17683-PD 430 CG17683-PD 5..430 48..473 2223 99.8 Plus
CG17683-PE 296 CG17683-PE 1..296 178..473 1567 100 Plus