Clone BO28794 Report

Search the DGRC for BO28794

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG9249-RB
Protein status:BO28794.pep: Imported from assembly
Sequenced Size:934

Clone Sequence Records

BO28794.complete Sequence

934 bp assembled on 2011-08-24

> BO28794.complete
GAAGTTATCAGTCGACATGATGCGAAATGCCTTGTTAGTAAGCGGCAAAC
TGAGACATTTGCTATCCTGTTCTATCGGGCGAAATTCGACTAGAAGCAGC
AGCACAGCGAAGTCGTTGGATGCCGGCACCCAAAAGGAAGTGCGGCACCA
TGAGAATCACGCCTCGGAGTGGTGGAATCAAAATGGAACCATGGGTGCTC
TACATGCCCTGAATGAGATTAGGGTTCCCTTTATCAGAGATGGCATCGTT
TCGCGTGGCACTGTGAAGCCAGGTTACGTAAATACCACCAAAGTGTTGTT
GGGTCAAAATATTCTGGAGGTCGGATGTGGCGGAGGATTGCTTACGGAAC
ACTTGGCGCGCCTGGGTGCCCAGGTGGCTGGCATAGATCTTGGCGAGAAG
TTAATAGAAGCTGCTCGCGAGCATCTCAAATGCTCCAGTCCGGAGTTGGC
CAGCAATGTGGTGTACAAAATTGAGCCGGTGGATCAGCATGCCAAGGCCA
ATTGCGAATGCTATGATGCGGTGATAGTGTCTGAAGTTCTGGAGCACGTC
AAAGATAAAGTGTCCCTGCTGGAGGCCAGTGTACGCAGCCTAAAGCCTGG
AGGATCCATCTTTATCACCACTTTGAACAAAACCATACCCAGTTGGTTCG
GTGGCGTGTTACTCAGCGAGTATGTTCTCAATCTGGTGCCCAGGGGAACG
CACCACTGGGACAAAATGATTTCGCCCTTGGACGTTCAGCGCATCTTGGA
TACGATGAACTGTCAGACGGTGTTGGTAAATGGAAGCACCTACGACTTTT
GGAGCAACACCTGGCGATGGATCAACAACAACCAGATGTGCTACGCCTTG
CAGGCGGTGAAACAAGCACAGCGCGAGTACAATGCAAGCTTTCTAGACCA
TTCAGTTTGGCGGCGGCGGAGCGGGCCGAGGGGG

BO28794.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-RB 870 CG9249-PB 1..867 17..883 4335 100 Plus
CG9249-RA 933 CG9249-PA 1..739 17..755 3695 100 Plus
CG9249-RA 933 CG9249-PA 803..930 756..883 640 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-RB 991 CG9249-RB 49..915 17..883 4335 100 Plus
CG9249-RA 1065 CG9249-RA 49..787 17..755 3695 100 Plus
CG9249-RA 1065 CG9249-RA 851..978 756..883 640 100 Plus
Mpp6-RA 1335 CG9250-RA 1170..1297 883..756 640 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21157711..21158245 755..221 2675 100 Minus
2L 23513712 2L 21158303..21158481 223..45 895 100 Minus
2L 23513712 2L 21157520..21157647 883..756 640 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:20:37 has no hits.

BO28794.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:18 Download gff for BO28794.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 26..898 17..891 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:35 Download gff for BO28794.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 49..921 17..891 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:41 Download gff for BO28794.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 49..921 17..891 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:41 Download gff for BO28794.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21158535..21158563 17..45 100   Minus
2L 21158304..21158480 46..222 100 <- Minus
2L 21157711..21158243 223..755 100 <- Minus
2L 21157514..21157647 756..891 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:35 Download gff for BO28794.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21158535..21158563 17..45 100   Minus
arm_2L 21158304..21158480 46..222 100 <- Minus
arm_2L 21157711..21158243 223..755 100 <- Minus
arm_2L 21157514..21157647 756..891 97 <- Minus

BO28794.pep Sequence

Translation from 16 to 934

> BO28794.pep
MMRNALLVSGKLRHLLSCSIGRNSTRSSSTAKSLDAGTQKEVRHHENHAS
EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNIL
EVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVY
KIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFI
TTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQ
TVLVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQREYNASFLDHSVWRR
RSGPRG

BO28794.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-PB 289 CG9249-PB 1..289 1..289 1519 100 Plus
CG9249-PA 310 CG9249-PA 1..310 1..289 1483 92.9 Plus