Clone BO28796 Report

Search the DGRC for BO28796

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptRbp2-RB
Protein status:BO28796.pep: Imported from assembly
Sequenced Size:1006

Clone Sequence Records

BO28796.complete Sequence

1006 bp assembled on 2011-08-24

GenBank Submission: KX799706

> BO28796.complete
GAAGTTATCAGTCGACATGGCTGGAAGAGGTGGTTATGAACACGCTAGCG
GATTCGGTGGGGATCGGGCATCCAAGCAGTTGCCCACGGAACCGCCGTTC
ATCGCATTTGTCGGCAATTTGCCGCAAGGCCTTGTGCAGGGCGATGTGAT
CAAAATATTCCAGGACTTTGAGGTGAAGTACGTGCGGCTGGTGAAGGACC
GGGAAACGGATCAGTTCAAAGGCTTCTGCTACGTCGAATTCGAGACGCTG
GACAATCTGGAGCGGGCGCTAGAGTGCGATGGTCGGATCAAACTGGACGA
TCTGTCGGCGCCGCTAAGGATCGACATTGCCGATCGGAGAAAAAATGATC
GCCCTGGTGGCGGTGTTGGCGGCGGCAACGGCGGCATGACCCGCGGCGAC
GGCGGCAGAGACGGTTTCCAGAAGCGCGGCCCACCTCGCCAGGGCGGCAG
CAGTCAGTCCTACAGCCGGGGAGGTCCTGGCACTGGCGGCGGCGGTCGGG
AGGGCGGCGGCGGTTCGGGTAATCGCGGCGATAGTAGAGATCGGCCGGCA
AATCGTGGTCGGTACGGCAGTTTCAATAACGACGATCGACCATTCGAGCG
TAACCAGGATCGGGATCGCGGTCAGCGGGAAGGCAGCTATGGCAACCAGT
CGCGCGACGGCGATCGCTACAACAACTTCAACCGGCACCGCGACCGCGAG
CGCACCCACTACAATCCCAACCAGCAGAGCGAACGTCCCAGTGGCGGCAT
GACCGGCCTTGGCGGCGGCTCCGGCGGATCAGGAGGCCTAGGCGTTGGCG
GTGGTTCCTCAATGGGCGCCATTGACGACAATGAGCGGCCACGTCTGCAG
CTGAAGCCACGGACCATTGCCGCGCCCATTAACGCGGTGGCAGAGACCAA
GCAATCGGCCTCGATCTTTGGCAACGCCAAGCCGCGCGAAGAGAAGCTGA
AGGAGCTGCAGCAGAATGTCAATCACAACGGCGATAACGCAAGCTTTCTA
GACCAT

BO28796.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-RB 975 CG4429-PB 1..972 17..988 4860 100 Plus
Rbp2-RA 978 CG4429-PA 1..975 17..988 4795 99.7 Plus
Rbp2-RE 954 CG4429-PE 12..951 49..988 4700 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-RB 3895 CG4429-RB 32..1005 15..988 4870 100 Plus
Rbp2-RA 3898 CG4429-RA 32..1008 15..988 4805 99.7 Plus
Rbp2-RE 2816 CG4429-RE 344..1283 49..988 4700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16449875..16450179 47..351 1525 100 Plus
X 23542271 X 16451273..16451559 538..824 1435 100 Plus
X 23542271 X 16450313..16450501 351..539 945 100 Plus
X 23542271 X 16451918..16452082 824..988 825 100 Plus
3R 32079331 3R 30726475..30726649 77..251 350 80 Plus
Blast to na_te.dros performed on 2014-11-27 06:34:49 has no hits.

BO28796.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:19 Download gff for BO28796.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 22..993 17..990 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:14 Download gff for BO28796.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 34..1005 17..990 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:48:45 Download gff for BO28796.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 34..1005 17..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:48:45 Download gff for BO28796.complete
Subject Subject Range Query Range Percent Splice Strand
X 16451919..16452082 825..990 98   Plus
X 16451275..16451559 540..824 100 -> Plus
X 16450314..16450501 352..539 100 -> Plus
X 16449877..16450179 49..351 100 -> Plus
X 16448698..16448729 17..48 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:14 Download gff for BO28796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16345952..16346115 825..990 98   Plus
arm_X 16345308..16345592 540..824 100 -> Plus
arm_X 16344347..16344534 352..539 100 -> Plus
arm_X 16343910..16344212 49..351 100 -> Plus
arm_X 16342731..16342762 17..48 100 -> Plus

BO28796.pep Sequence

Translation from 16 to 1006

> BO28796.pep
MAGRGGYEHASGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQD
FEVKYVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPL
RIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQSYS
RGGPGTGGGGREGGGGSGNRGDSRDRPANRGRYGSFNNDDRPFERNQDRD
RGQREGSYGNQSRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGLGG
GSGGSGGLGVGGGSSMGAIDDNERPRLQLKPRTIAAPINAVAETKQSASI
FGNAKPREEKLKELQQNVNHNGDNASFLDH

BO28796.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-PB 324 CG4429-PB 1..324 1..324 1741 100 Plus
Rbp2-PA 325 CG4429-PA 1..325 1..324 1729 99.7 Plus
Rbp2-PC 358 CG4429-PC 1..358 1..324 1685 90.5 Plus
Rbp2-PE 317 CG4429-PE 5..317 12..324 1681 100 Plus
Rbp2-PD 388 CG4429-PD 1..388 1..324 1644 83.5 Plus