Clone BO28819 Report

Search the DGRC for BO28819

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptNop56-RA
Protein status:BO28819.pep: Imported from assembly
Sequenced Size:1522

Clone Sequence Records

BO28819.complete Sequence

1522 bp assembled on 2011-08-24

GenBank Submission: KX797390

> BO28819.complete
GAAGTTATCAGTCGACATGTCGAACCTGTATGTGCTGTACGAGCATGCGG
CGGGCTTCTCGCTCTTCTCCGTCAAGGAGTTCGAAGAGGTGTCCATGTTC
CTGCCCCAGGTGGAGTCCTCGGTGACGGACCTCGCCAAGTTCAACTCAAT
TGTTAAGCTGGCTGGATTTGCACCTTTCAAGACGGCCATTGCCGCACTGG
AAAACATCAATGCCATATCCGAGGGCATAGTGCCGCAGGATCTGCTCTCC
TTCTTGGATGACTTCTTTGCCAAGCTGAAGAAGAAGAAGTGCACCCTGGG
TATTGCGGATGCCAAGCTGGGAGCTGCAATCACCGAGGCCATTGGCGTCC
AGTGCAGTCACTTTGGAGTGGTTCCTGAGATTCTGCGCGGCGTGCGATTC
CACTTCGCTAAGCTGGTCAAGGGATTCACCGACAAGTCCGCTGGCGTTGC
TCAGCTGGGTCTGGGCCACAGCTACTCGCGTGCCAAGGTCAAGTTCAATG
TTCATCGTTCCGACAACATGATCATCCAGTCGATTGCTTTGCTGGATCAG
TTGGATAAGGACGTAAATACCTTCTCTATGCGGATACGCGAGTGGTACTC
GTATCACTTCCCAGAACTGGTCAAAATCGTTCCCGACAATTACATGTTCG
CCAAGGCGGCCAAGTTCATCAAGGATCGCAAGAACCTCACGCAAGACCAG
CTGGAGGATCTTGAGAAGATCGTCATGGACTCCGCCAAGGCTCAGGCTAT
CATTGATGCCGCCAAGATGTCCATGGGCATGGACATCTCCATTGTTGATC
TGATGAACATTGAGCTGTTCGCAGAGCGCGTTGTCAAGCTTTCCGAGTAC
CGAAAGAAACTGTCTACCTACTTGCACAACAAGATGAACTTGGTGGCACC
CAATCTGCAGTCTTTGATTGGCGACCAGGTCGGTGCCCGCCTGATATCGC
ATGCCGGCAGCTTGACTAATCTGGCCAAGTACCCAGCATCTACAGTACAA
ATCCTGGGTGCCGAGAAGGCGCTCTTCCGTGCTCTAAAGACCCGCTCCAA
TACGCCCAAGTATGGTCTTATCTATCACTCCTCGTTCATTGGTCGAGCTG
GCCTGAAGAACAAGGGTCGCATCTCTCGATTCCTGGCCAACAAGTGCTCC
ATCGCGTCGCGTATCGATTGCTTCCTGGAACAGCCGACTAGCGTGTTTGG
CGAAACTCTTAAGCAACAGGTCGAAGATCGCCTCAAGTTCTACGAGTCCG
GCGATGTGCCGCGCAAGAACATTGAGGTAATGAAGGAGGCCATCGAGGCA
GCTGGTCAAGAGGCGGCAATCACTGTACAGTCCGAGAAAAAGAAGAAAAA
GAAGAAGCGAGCGGCTGAAGACGAGGGCGAGACGAATGGCGCCAGTAATG
GAAACGGAGCAGCCGCCGAGGCGGAAAATGGCAATGGCAACGATGATGGA
GAGCCAAAGAAGAAGAAGAAAAAGAAGAACAAAAACAAGGAAGCGGTGGA
GGCGGCAAGCTTTCTAGACCAT

BO28819.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-RA 1491 CG13849-PA 1..1488 17..1504 7440 100 Plus
nop5-RA 1536 CG10206-PA 883..1070 929..1116 220 74.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-RA 1746 CG13849-RA 110..1600 14..1504 7455 100 Plus
nop5-RA 1813 CG10206-RA 1015..1202 929..1116 220 74.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22419241..22420323 1504..422 5415 100 Minus
3R 32079331 3R 22420387..22420791 423..19 2025 100 Minus
2L 23513712 2L 6917542..6917729 1116..929 220 74.5 Minus
Blast to na_te.dros performed on 2014-11-27 07:01:51 has no hits.

BO28819.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:07 Download gff for BO28819.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 113..1600 17..1506 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:53 Download gff for BO28819.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 113..1600 17..1506 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:13 Download gff for BO28819.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 113..1600 17..1506 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:13 Download gff for BO28819.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22420388..22420792 17..422 99   Minus
3R 22419239..22420322 423..1506 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:53 Download gff for BO28819.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18246110..18246514 17..422 99   Minus
arm_3R 18244961..18246044 423..1506 99 <- Minus

BO28819.pep Sequence

Translation from 16 to 1522

> BO28819.pep
MSNLYVLYEHAAGFSLFSVKEFEEVSMFLPQVESSVTDLAKFNSIVKLAG
FAPFKTAIAALENINAISEGIVPQDLLSFLDDFFAKLKKKKCTLGIADAK
LGAAITEAIGVQCSHFGVVPEILRGVRFHFAKLVKGFTDKSAGVAQLGLG
HSYSRAKVKFNVHRSDNMIIQSIALLDQLDKDVNTFSMRIREWYSYHFPE
LVKIVPDNYMFAKAAKFIKDRKNLTQDQLEDLEKIVMDSAKAQAIIDAAK
MSMGMDISIVDLMNIELFAERVVKLSEYRKKLSTYLHNKMNLVAPNLQSL
IGDQVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYG
LIYHSSFIGRAGLKNKGRISRFLANKCSIASRIDCFLEQPTSVFGETLKQ
QVEDRLKFYESGDVPRKNIEVMKEAIEAAGQEAAITVQSEKKKKKKKRAA
EDEGETNGASNGNGAAAEAENGNGNDDGEPKKKKKKKNKNKEAVEAASFL
DH

BO28819.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-PA 496 CG13849-PA 1..496 1..496 2488 100 Plus
nop5-PA 511 CG10206-PA 1..490 4..498 854 40.1 Plus
Prp31-PA 501 CG6876-PA 100..378 168..453 262 24.3 Plus