Clone BO28826 Report

Search the DGRC for BO28826

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptNrx-IV-RB
Protein status:BO28826.pep: Imported from assembly
Sequenced Size:3886

Clone Sequence Records

BO28826.complete Sequence

3886 bp assembled on 2011-09-19

GenBank Submission: KX794006

> BO28826.complete
GAAGTTATCAGTCGACATGAGGCCGCCCAGGAGCAATACGAAAGCAGCAT
TTTCCTCGCTTCAGTTTGGATTGTTATGCCTCCTATTGCTGGTCAATAAT
GGCATTAAATCGGTGCAAGCAGACGCCTTCACGGACTATTTCTCCGACTA
CGATTGCAACCAGCCGCTGATGGAAAGAGCCGTCCTCACGGCCACATCAT
CCTTGACGGAAAGAGGACCCGACAAAGCACGACTAAACGCTGGCACCTCG
TGGTCCGCGAAGAACTCGGATTTCGACCAGCGTCTGATTATTGACCTGGG
CGTGGTGCGGAACGTGACGCACATCGCCCTGCAAGGACGACCACATAGCA
ATGAGTACGTCACCGAGTACACCATTAGCTATGGCATAACCGATCTAGAG
TTTGCCGACTATAAAGAGCCGGGCGGCAATGTCAAGATGTTCAAGGGCAA
CTCCGATGGCAACTCTATCCATTACAACGTCTTCGAGGTGCCCATTATTG
CCCAATGGGTGAGGATCAATCCCACCAGGTGGCACGATCGTATTTCCATG
CGTGTGGAGCTCTACGGCTGCGATTACATCTCTGAAAACCTATACTTTAA
TGGCACTGGCTTGGTGCGCTATGATCTGAGGCGGGAACCCATTACCTCCA
CCAAAGAGTCCATCCGCTTCCGCTTCAAGACGGCCTTTGCCAACGGAGTG
ATGATGTATTCGCGTGGCACACAAGGGGATTACTATGCCCTGCAGCTTAA
GGACAACAAAATGGTGCTGAATTTGGATTTGGGATCGCGGGTGATGACCT
CCTTATCGGTGGGCAGCCTGCTGGATGATAATGTGTGGCATGACGTTGTG
ATCTCAAGGAATCAAAGGGACATAATCTTCTCAGTGGATCGTGTCATCGT
AAGAGGACGCATCCAAGGCGAGTTCACACGACTGAATCTTAATAGGGAGC
TGTATCTAGGTGGTGTGCCCAACGTACAAGAGGGCTTGATTGTCCAACAA
AATTTCTCCGGCTGCTTAGAAAACATCTACTTTAATTCGACCAACTTTAT
TCGAGTGATGAAAGACAGCACTGAACTGGGAGAGGGATATCTCTTCACTA
GGGTAAACACGATCTACGCGTGTCCTTCGCCTCCGATTTATCCGGTGACC
TTCACTACCCGTTCGTCGTTCGTCCGTTTGAAGGGTTATGAAAATTCGCA
GCGTCTTAACGTCTCCTTCTATTTCCGTACTTACGAGGAAACTGGAGTAA
TGCTGCATCACGACTTCTATTCGGGTGGTTATCTAAAGGTCTTTTTGGAG
TTTGGCAAAGTGAAAATTGATCTTAAAGTCAAGGACAAAGCGCGAATCAT
TCTGGACAACTACGATGATCAGTTCAATGATGGCAAATGGCATTCGTTCG
TTATATCCATCGAAAAGAATCGCTTGATTTTAAATATTGATCAGAGACCG
ATGACCACAACAAAGAGCATGCAGGTTGCCACTGGAGCACAGTACTATAT
TGCTGGTGGAAAGGACAAAAATGGATTTGTCGGTTGCATGCGCTTAATTT
CGGTGGATGGAAATTACAAATTACCGCAGGACTGGGTGAAGGGCGAGGAG
GTTTGCTGTGGCGATGATGTCGTCGTCGATGCCTGCCAGATGATTGATCG
CTGCAACCCGAATCCTTGCCAGCATAAGGGACTTTGTCACCAAAACTCCA
GGGAGTTCTTCTGTGATTGCGGACATACTGGCTACGCCGGAGCTGTTTGC
CATACATCAAACAATCCATTGTCCTGCTTGGCTCTCAAGAATGTCCAGCA
TGTGCAGCAGCGTGTGAACTTGAATCTCGATGTGGATGGCAGTGGTCCCC
TAGAACCTTTCCCAGTGACCTGCGAGTTCTACTCGGATGGACGCGTGATT
ACCACCCTCAGTCACAGTCAAGAGCACACCACAACAGTAGATGGTTTTCA
GGAGCCTGGCTCCTTTGAGCAGTCCATCATGTACGATGCCAACCAACTGC
AAATTGAAGCTCTGTTGAATCGGTCTCATAGCTGCTGGCAGCGCCTGAGC
TACTCCTGCCGCTCCTCCCGACTCTTCAACTCGCCATCTGAGGCCGGAAA
TTTCCGTCCCTTCTCTTGGTGGATATCTCGCCACAATCAACCGATGGACT
ATTGGGCTGGAGCTCTACCTGGCTCTCGTAAGTGCGAATGTGGAATTCTG
GGCAAGTGTCACGATCCCACAAAGTGGTGCAACTGCGATTCGAACAGTCT
GGAATGGATGGAGGATGGTGGTGATATCCGGGAGAAGGAATACCTTCCCG
TGCGAGCTGTGAAGTTTGGCGACACTGGAACTCCGTTGGACGAGAAAATG
GGTCGCTATACTCTGGGACCGCTGCGCTGTGAGGGCGATGATCTGTTCAG
TAATGTGGTGACCTTCCGCATTGCCGATGCTTCTATTAACTTACCACCAT
TCGATATGGGTCACTCTGGAGATATTTATCTGGAATTCCGTACCACACAA
GAGAACTCTGTGATCTTCCATGCTACCGGACCTACAGATTACATTAAGCT
AAGTCTCAATGGCGGCAACAAATTGCAATTCCAGTATCAGGCGGGAAGTG
GTCCACTGGGCGTTAATGTGGGCACAAGCTATCACCTGAACGACAACAAC
TGGCACACGGTTAGTGTCGAGCGCAACAGGAAGGAGGCTCGTCTGGTGGT
TGATGGTTCTATCAAGGCTGAGGTTCGAGAGCCGCCGGGTCCAGTGCGTG
CACTTCACTTAACATCGGATCTGGTGATTGGCGCCACTACTGAGTACCGC
GATGGTTACGTAGGATGCATTCGTGCACTGCTGCTGAACGGAAAGATGGT
TGACTTGAAGGAATACTCCAAGCGTGGATTATACGGCATCAGCACCGGTT
GCGTGGGTCGCTGTGAATCAAATCCATGCCTAAACAATGGTACTTGTATC
GAGCGATACGATGGCTACAGCTGCGATTGCCGTTGGAGCGCATTCAAAGG
ACCTATTTGCGCAGATGAGATTGGTGTCAACCTACGCTCCAGTTCGATTA
TTCGCTACGAGTTCGAGGGTTCCTTCCGCTCCACAATTGCCGAGAACATT
CGCGTCGGTTTCACCACCACCATTCCGAAGGGATTCCTGCTTGGCTTCTC
TTCCAACCTAACTGGCGAATATTTAACTATTCAAATATCGAATTCTGGTC
ATTTGCGTTGTGTATTTGATTTCGGTTTCGAGAGGCAGGAAATCATATTC
CCCAAAAAACATTTTGGCCTGGGTCAGTACCACGATATGCACTTTATGCG
CAAGAATGGTGGATCCACAGTGGTTTTGAAGGTTGACAACTACGAGCCGG
TCGAGTATAATTTTGATATTAAGGCCTCAGCGGATGCTCAATTCAACAAT
ATCCAGTACATGTACATTGGCAAAAATGAATCTATGACAGATGGCTTTGT
GGGTTGTGTGTCGCGAGTTCAATTCGATGATATCTATCCACTGAAGCTGA
TGTTCCAGCAGAATCCTCCCAAGAATGTCAAATCATTGGGCACTCAATTG
ACTGAAGATTTCTGCGGAGTGGAGCCAGTTACGCATCCGCCCATTGAAAT
CGAGACTAGGCCACCACCCTTGGTGGATGAGGAGAAGTTGCGCAAGGCAT
ACAATGAAGTTGACTCTGTGCTGTTGGCATGTCTGCTTGTGATTCTCTTC
CTGCTGCTGATCCTTATGTTCTTCCTTATCGGTCGCTATTTGCACCGACA
CAAAGGCGACTACCTGACGCACGAGGATCAGGGTGCCGATGGAGCTGACG
ATCCAGACGATGCTGTCCTGCACTCAACTACTGGCCATCAAGTCAGGAAG
CGAACAGAGATCTTTATCGCAAGCTTTCTAGACCAT

BO28826.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-RB 3855 CG6827-PB 1..3852 17..3868 19260 100 Plus
Nrx-IV-RA 3855 CG6827-PA 419..3852 435..3868 17170 100 Plus
Nrx-IV-RA 3855 CG6827-PA 1..223 17..239 1115 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-RB 4940 CG6827-RB 337..4188 17..3868 19260 100 Plus
Nrx-IV-RA 4940 CG6827-RA 755..4188 435..3868 17170 100 Plus
Nrx-IV-RA 4940 CG6827-RA 337..559 17..239 1115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12152380..12153558 579..1757 5895 100 Plus
3L 28110227 3L 12154210..12155143 2084..3017 4655 99.9 Plus
3L 28110227 3L 12155441..12155790 3193..3542 1735 99.7 Plus
3L 28110227 3L 12153951..12154159 1884..2092 1030 99.5 Plus
3L 28110227 3L 12151210..12151407 239..436 990 100 Plus
3L 28110227 3L 12156051..12156238 3681..3868 940 100 Plus
3L 28110227 3L 12155202..12155384 3017..3199 915 100 Plus
3L 28110227 3L 12152175..12152318 435..578 720 100 Plus
3L 28110227 3L 12155855..12155994 3543..3682 700 100 Plus
3L 28110227 3L 12153623..12153748 1758..1883 630 100 Plus
3L 28110227 3L 12148789..12148908 120..239 600 100 Plus
3L 28110227 3L 12146855..12146960 17..122 530 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:30:05 has no hits.

BO28826.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:08 Download gff for BO28826.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 281..4132 17..3870 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:21 Download gff for BO28826.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 337..4188 17..3870 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:26 Download gff for BO28826.complete
Subject Subject Range Query Range Percent Splice Strand
Nrx-IV-RB 337..4188 17..3870 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:23:26 Download gff for BO28826.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12156051..12156238 3681..3870 98   Plus
3L 12155855..12155992 3543..3680 100 -> Plus
3L 12155446..12155790 3198..3542 100 -> Plus
3L 12155203..12155382 3018..3197 100 -> Plus
3L 12154214..12155143 2088..3017 100 -> Plus
3L 12153951..12154154 1884..2087 100 -> Plus
3L 12153623..12153748 1758..1883 100 -> Plus
3L 12152380..12153558 579..1757 100 -> Plus
3L 12152177..12152318 437..578 100 -> Plus
3L 12151211..12151407 240..436 100 -> Plus
3L 12148792..12148908 123..239 100 -> Plus
3L 12146855..12146960 17..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:21 Download gff for BO28826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12149151..12149338 3681..3870 98   Plus
arm_3L 12148955..12149092 3543..3680 100 -> Plus
arm_3L 12148546..12148890 3198..3542 100 -> Plus
arm_3L 12148303..12148482 3018..3197 100 -> Plus
arm_3L 12147314..12148243 2088..3017 100 -> Plus
arm_3L 12147051..12147254 1884..2087 100 -> Plus
arm_3L 12146723..12146848 1758..1883 100 -> Plus
arm_3L 12145480..12146658 579..1757 100 -> Plus
arm_3L 12145277..12145418 437..578 100 -> Plus
arm_3L 12144311..12144507 240..436 100 -> Plus
arm_3L 12141892..12142008 123..239 100 -> Plus
arm_3L 12139955..12140060 17..122 100 -> Plus

BO28826.pep Sequence

Translation from 16 to 3886

> BO28826.pep
MRPPRSNTKAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQP
LMERAVLTATSSLTERGPDKARLNAGTSWSAKNSDFDQRLIIDLGVVRNV
THIALQGRPHSNEYVTEYTISYGITDLEFADYKEPGGNVKMFKGNSDGNS
IHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENLYFNGTGLV
RYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYYALQLKDNKMV
LNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQ
GEFTRLNLNRELYLGGVPNVQEGLIVQQNFSGCLENIYFNSTNFIRVMKD
STELGEGYLFTRVNTIYACPSPPIYPVTFTTRSSFVRLKGYENSQRLNVS
FYFRTYEETGVMLHHDFYSGGYLKVFLEFGKVKIDLKVKDKARIILDNYD
DQFNDGKWHSFVISIEKNRLILNIDQRPMTTTKSMQVATGAQYYIAGGKD
KNGFVGCMRLISVDGNYKLPQDWVKGEEVCCGDDVVVDACQMIDRCNPNP
CQHKGLCHQNSREFFCDCGHTGYAGAVCHTSNNPLSCLALKNVQHVQQRV
NLNLDVDGSGPLEPFPVTCEFYSDGRVITTLSHSQEHTTTVDGFQEPGSF
EQSIMYDANQLQIEALLNRSHSCWQRLSYSCRSSRLFNSPSEAGNFRPFS
WWISRHNQPMDYWAGALPGSRKCECGILGKCHDPTKWCNCDSNSLEWMED
GGDIREKEYLPVRAVKFGDTGTPLDEKMGRYTLGPLRCEGDDLFSNVVTF
RIADASINLPPFDMGHSGDIYLEFRTTQENSVIFHATGPTDYIKLSLNGG
NKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIK
AEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEY
SKRGLYGISTGCVGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICAD
EIGVNLRSSSIIRYEFEGSFRSTIAENIRVGFTTTIPKGFLLGFSSNLTG
EYLTIQISNSGHLRCVFDFGFERQEIIFPKKHFGLGQYHDMHFMRKNGGS
TVVLKVDNYEPVEYNFDIKASADAQFNNIQYMYIGKNESMTDGFVGCVSR
VQFDDIYPLKLMFQQNPPKNVKSLGTQLTEDFCGVEPVTHPPIEIETRPP
PLVDEEKLRKAYNEVDSVLLACLLVILFLLLILMFFLIGRYLHRHKGDYL
THEDQGADGADDPDDAVLHSTTGHQVRKRTEIFIASFLDH

BO28826.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Nrx-IV-PB 1284 CG6827-PB 1..1284 1..1284 6890 100 Plus
Nrx-IV-PA 1284 CG6827-PA 1..1284 1..1284 6636 96.4 Plus
axo-PI 2047 CG43225-PI 476..1311 185..1015 651 25.2 Plus
axo-PD 2070 CG43225-PD 476..1311 185..1015 651 25.2 Plus
axo-PH 2070 CG43225-PH 476..1311 185..1015 651 25.2 Plus
axo-PI 2047 CG43225-PI 1489..1800 929..1212 196 22 Plus
axo-PD 2070 CG43225-PD 1489..1800 929..1212 196 22 Plus
axo-PI 2047 CG43225-PI 220..676 768..1191 179 23.5 Plus
axo-PD 2070 CG43225-PD 220..676 768..1191 179 23.5 Plus