Clone BO28829 Report

Search the DGRC for BO28829

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptLmpt-RD
Protein status:BO28829.pep: Imported from assembly
Sequenced Size:1708

Clone Sequence Records

BO28829.complete Sequence

1708 bp assembled on 2011-09-19

GenBank Submission: KX795326

> BO28829.complete
GAAGTTATCAGTCGACATGGTGAAAATGCTCGATCTGGACCGTCACGCAG
AGTGCCCACTGTGGGCGGCACTGGCCTCCTCGGATGTCCCATGGACGGGA
ATGGACTACGCCTGCCTGAACGTGCTCAGTATCTACTGCAAAGTATTCGA
TAGGAAGGAAATATACGATCTCATCGTGAGGAAAACCTGCCAGTCCTGCA
AATGTCCTCGCGAGGCGCATGCCATCTATCAGCAACAGACTACCAACGTG
CATGAGCGACTCGGCTTCAAATTGGTCTCTCCGGCGGATTCGGGAGTGGA
GGCGCGGGATCTGGGCTTCACGTGGGTTCCGCCCGGAGTGCGTGCCTCCT
CGCGCATCAACCGCTACTTCGAGCAGCTGCCCGACGAAATGGTACCCCGG
CTGGGCAGCGAAGGCGCCTGCAGCCGGGAGCGACAGATCTCTTACCAGCT
GCCCAAACAGGACCTCTCGCTGGAGCACTGCAAGCACCTGGAGGTGCAGC
ACGAGGCTTCCTTCGAGGACTTTGTGACGGCGCGAAACGAAATCGCACTG
GACATAGCCTACATCAAGGATGCCCCCTACGATGAGCATTGTGCGCACTG
TGATAACGAGATAGCCGCCGGCGAGCTAGTTGTGGCGGCGCCCAAGTTTG
TGGAGAGCGTGATGTGGCACCCAAAGTGCTTCACCTGCAGCACCTGCAAC
TCGCTACTCGTGGACCTCACCTACTGCGTCCACGACGACAAGGTCTACTG
CGAGCGCCACTATGCGGAAATGCTGAAGCCCCGCTGCGCTGGCTGTGATG
AGTTAATTTTCAGTGGCGAGTACACAAAAGCCATGGACAAGGACTGGCAC
TCCGGACACTTCTGCTGCTGGCAATGCGACGAGAGCCTCACCGGACAGCG
TTACGTCATCCGGGACGATCATCCGTACTGCATCAAGTGCTACGAGAATG
TGTTCGCCAATACGTGCGAGGAGTGCAACAAGATCATTGGCATCGACTCC
AAGGATCTGTCCTACAAAGACAAGCACTGGCACGAGGCCTGTTTCCTGTG
CTTCAAGTGCCATCTGTCGCTGGTGGACAAGCAGTTTGGAGCCAAGGCGG
ATAAGATCTACTGTGGAAACTGCTACGATGCCCAGTTTGCGTCCCGCTGC
GATGGCTGCGGCGAAGTTTTCCGCGCAGGCACCAAGAAAATGGAGTATAA
AACCAGGCAGTGGCACGAGAATTGCTTCTGCTGCTGCGTCTGCAAGACGG
CCATTGGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTATTGCGCC
GGCTGCTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGT
CATCACCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGT
GCTTCACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACC
AGCCGCGACGAGAAGCCCTATTGTGCGGAGTGCTTTGGCGAGCTCTTTGC
CAAAAGGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACAC
GCTTCATATCGTTTGAGGATCGCCACTGGCATCACGACTGCTTTGTGTGT
GCCAGCTGCAAGGCTAGTCTGGTTGGTCGTGGCTTCATCACCGACGGACC
CGATATCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATGGCAAGCTTTC
TAGACCAT

BO28829.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-RD 1677 CG42679-PD 1..1674 17..1690 8370 100 Plus
Lmpt-RH 1677 CG42679-PH 1..1674 17..1690 8370 100 Plus
Lmpt-RM 1680 CG42679-PM 165..1677 178..1690 7565 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-RD 2860 CG32171-RD 291..1964 17..1690 8370 100 Plus
Lmpt-RH 2804 CG32171-RH 235..1908 17..1690 8370 100 Plus
Lmpt-RM 2905 CG42679-RM 497..2009 178..1690 7565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16896802..16897180 179..557 1895 100 Plus
3L 28110227 3L 16897380..16897628 554..802 1245 100 Plus
3L 28110227 3L 16912127..16912330 801..1004 1020 100 Plus
3L 28110227 3L 16921178..16921367 1347..1536 950 100 Plus
3L 28110227 3L 16913222..16913399 1002..1179 890 100 Plus
3L 28110227 3L 16920879..16921053 1176..1350 875 100 Plus
3L 28110227 3L 16896436..16896600 17..181 825 100 Plus
3L 28110227 3L 16921430..16921591 1529..1690 795 99.4 Plus
Blast to na_te.dros performed on 2014-11-27 10:35:28 has no hits.

BO28829.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:09 Download gff for BO28829.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 289..1962 17..1692 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:40:12 Download gff for BO28829.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RH 235..1908 17..1692 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:49 Download gff for BO28829.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RH 235..1908 17..1692 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:25:49 Download gff for BO28829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16921437..16921591 1536..1692 98   Plus
3L 16921180..16921366 1349..1535 100 -> Plus
3L 16920882..16921051 1179..1348 100 -> Plus
3L 16913224..16913398 1004..1178 100 -> Plus
3L 16912129..16912329 803..1003 100 -> Plus
3L 16897384..16897628 558..802 100 -> Plus
3L 16896804..16897180 181..557 100 -> Plus
3L 16896436..16896599 17..180 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:40:12 Download gff for BO28829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16914537..16914691 1536..1692 98   Plus
arm_3L 16914280..16914466 1349..1535 100 -> Plus
arm_3L 16913982..16914151 1179..1348 100 -> Plus
arm_3L 16906324..16906498 1004..1178 100 -> Plus
arm_3L 16905229..16905429 803..1003 100 -> Plus
arm_3L 16890484..16890728 558..802 100 -> Plus
arm_3L 16889904..16890280 181..557 100 -> Plus
arm_3L 16889536..16889699 17..180 100 -> Plus

BO28829.pep Sequence

Translation from 16 to 1708

> BO28829.pep
MVKMLDLDRHAECPLWAALASSDVPWTGMDYACLNVLSIYCKVFDRKEIY
DLIVRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVEARDLG
FTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDL
SLEHCKHLEVQHEASFEDFVTARNEIALDIAYIKDAPYDEHCAHCDNEIA
AGELVVAAPKFVESVMWHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYA
EMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRD
DHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHL
SLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWH
ENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGG
VTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTA
CVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCP
DCAKQKLMASFLDH

BO28829.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-PD 558 CG32171-PD 1..558 1..558 3160 100 Plus
Lmpt-PH 558 CG32171-PH 1..558 1..558 3160 100 Plus
Lmpt-PM 559 CG42679-PM 56..559 55..558 2867 100 Plus
Lmpt-PN 529 CG42679-PN 26..529 55..558 2867 100 Plus
Lmpt-PB 559 CG32171-PB 56..559 55..558 2867 100 Plus