Clone BO28836 Report

Search the DGRC for BO28836

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptYp3-RA
Protein status:BO28836.pep: Imported from assembly
Sequenced Size:1294

Clone Sequence Records

BO28836.complete Sequence

1294 bp assembled on 2011-08-24

GenBank Submission: KX796885

> BO28836.complete
GAAGTTATCAGTCGACATGATGAGTCTAAGGATTTGCCTGCTGGCCACCT
GCCTCCTGGTGGCGGCCCATGCCTCCAAGGATGCCTCCAATGACCGACTG
AAGCCGACCAAGTGGCTGACCGCCACCGAGCTGGAGAACGTGCCCTCCCT
CAACGACATCACCTGGGAGCGTTTGGAGAATCAGCCGCTGGAGCAGGGCG
CCAAGGTGATCGAGAAGATCTACCACGTTGGCCAAATCAAGCACGATCTG
ACCCCCAGCTTTGTGCCCAGCCCGAGCAATGTGCCCGTCTGGATTATCAA
GTCCAATGGACAGAAGGTTGAGTGCAAGTTGAACAACTATGTGGAGACGG
CCAAGGCACAGCCCGGATTCGGCGAGGATGAGGTCACCATTGTCCTGACT
GGTCTGCCCAAGACCAGCCCCGCTCAGCAGAAGGCCATGCGCAGGTTGAT
CCAGGCCTACGTCCAGAAGTACAACCTCCAGCAGCTGCAGAAGAACGCCC
AGGAGCAGCAGCAGCAGCTCAAGAGCAGCGACTACGACTACACCAGCAGC
GAGGAGGCCGCTGACCAATGGAAATCCGCCAAGGCTGCCAGCGGCGATTT
GATCATCATTGACCTCGGCTCCACCCTGACCAACTTCAAACGCTACGCGA
TGCTGGATGTTCTGAACACCGGCGCCATGATCGGCCAGACCCTGATCGAT
CTGACCAACAAGGGTGTGCCCCAGGAGATCATCCATCTGATCGGCCAGGG
AATCAGCGCCCATGTGGCCGGAGCTGCTGGCAACAAGTACACCGCCCAAA
CCGGACACAAGCTGCGCCGCATCACCGGTCTGGATCCCGCCAAGGTGCTG
TCCAAGCGTCCCCAGATCCTGGGTGGTCTGTCCCGCGGCGATGCTGACTT
CGTTGATGCCATTCACACATCGACCTTCGCCATGGGCACGCCCATCCGTT
GCGGCGATGTTGACTTCTACCCCAACGGACCGTCCACCGGTGTTCCCGGC
TCCGAGAATGTGATCGAGGCTGTGGCCCGTGCCACCCGTTACTTTGCCGA
GTCTGTGCGTCCCGGTAGCGAGCGCAATTTCCCCGCCGTTCCGGCCAACT
CGCTGAAGCAGTACAAGGAGCAGGATGGCTTTGGCAAGCGCGCCTACATG
GGTCTCCAGATCGACTACGATCTGCGCGGTGACTACATCTTGGAGGTCAA
CGCCAAGAGCCCCTTCGGTCAGCGCAGCCCTGCCCACAAGCAGGCCGCCT
ACCATGGCATGCACCACGCCCAGAACGCAAGCTTTCTAGACCAT

BO28836.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-RB 1263 CG11129-PB 1..1260 17..1276 6300 100 Plus
Yp3-RA 1263 CG11129-PA 1..1260 17..1276 6300 100 Plus
Yp1-RB 1320 CG2985-PB 814..1221 800..1207 720 78.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-RB 1868 CG11129-RB 57..1316 17..1276 6300 100 Plus
Yp3-RA 1488 CG11129-RA 57..1316 17..1276 6300 100 Plus
Yp1-RB 1611 CG2985-RB 920..1327 800..1207 720 78.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13760324..13760995 605..1276 3360 100 Plus
X 23542271 X 13759869..13760251 222..604 1915 100 Plus
X 23542271 X 13759602..13759806 17..221 1025 100 Plus
X 23542271 X 10054807..10055214 800..1207 720 78.4 Plus
X 23542271 X 10051245..10051783 1254..716 520 73.1 Minus
Blast to na_te.dros performed on 2014-11-27 07:02:40 has no hits.

BO28836.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:08 Download gff for BO28836.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 58..1317 17..1278 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:17 Download gff for BO28836.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 58..1317 17..1278 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:32 Download gff for BO28836.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 57..1316 17..1278 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:32 Download gff for BO28836.complete
Subject Subject Range Query Range Percent Splice Strand
X 13760324..13760995 605..1278 99   Plus
X 13759869..13760251 222..604 100 -> Plus
X 13759602..13759806 17..221 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:17 Download gff for BO28836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13654357..13655028 605..1278 99   Plus
arm_X 13653902..13654284 222..604 100 -> Plus
arm_X 13653635..13653839 17..221 100 -> Plus

BO28836.pep Sequence

Translation from 16 to 1294

> BO28836.pep
MMSLRICLLATCLLVAAHASKDASNDRLKPTKWLTATELENVPSLNDITW
ERLENQPLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNVPVWIIKSNGQK
VECKLNNYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKAMRRLIQAYVQ
KYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDL
GSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHV
AGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIH
TSTFAMGTPIRCGDVDFYPNGPSTGVPGSENVIEAVARATRYFAESVRPG
SERNFPAVPANSLKQYKEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPF
GQRSPAHKQAAYHGMHHAQNASFLDH

BO28836.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-PB 420 CG11129-PB 1..420 1..420 2178 100 Plus
Yp3-PA 420 CG11129-PA 1..420 1..420 2178 100 Plus
Yp1-PB 439 CG2985-PB 1..432 1..422 1229 54.4 Plus
Yp1-PA 439 CG2985-PA 1..432 1..422 1229 54.4 Plus
Yp2-PB 442 CG2979-PB 1..427 1..416 1099 49.7 Plus