Clone BO28839 Report

Search the DGRC for BO28839

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG32280-RA
Protein status:BO28839.pep: Imported from assembly
Sequenced Size:424

Clone Sequence Records

BO28839.complete Sequence

424 bp assembled on 2011-08-24

GenBank Submission: KX798701

> BO28839.complete
GAAGTTATCAGTCGACATGAGTAAACCTGGCAGTGCTCCTCCGCAGTTCA
CCTATGTGCCGCCCCCTTCGGCCCCGCCCTCTTACCAGGAGGCGGTGGGC
GGAGTGAAGCCGGTGGGTCCATATACGCCCGTGGTGGCGCCCGCAACCAC
GGCAAATACCACGATTGTGACCACGGTTGTGCCCATTAGCCGCACTTCGA
CGCACATGATCTGTCCATCGTGCCATGCCGAGATCGAGACGACTACGCGC
ACCGAGCCGGGAATGATTGCCTACTTGTCCGGATTTTTGATTGCCCTATT
TGGTTGCTGGCTGGGATGCTGCCTAATACCTTGCTGCATCGACGACTGCA
TGGATGTGCATCACTCGTGCCCCAACTGCCGCGCATATTTGGGGCGATAC
CGTCGAGCAAGCTTTCTAGACCAT

BO28839.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-RD 393 CG32280-PD 1..390 17..406 1950 100 Plus
CG32280-RC 393 CG32280-PC 1..390 17..406 1950 100 Plus
CG32280-RB 393 CG32280-PB 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-RD 1279 CG32280-RD 245..636 15..406 1960 100 Plus
CG32280-RC 1440 CG32280-RC 406..797 15..406 1960 100 Plus
CG32280-RB 1144 CG32280-RB 110..501 15..406 1960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3167977..3168265 15..303 1445 100 Plus
3L 28110227 3L 3168334..3168437 303..406 520 100 Plus
Blast to na_te.dros performed 2014-11-27 07:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 2582..2683 378..275 118 61 Minus

BO28839.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:09 Download gff for BO28839.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RC 408..797 17..408 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:42 Download gff for BO28839.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 79..468 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:53 Download gff for BO28839.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RB 112..501 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:53 Download gff for BO28839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3168335..3168437 304..408 98   Plus
3L 3167979..3168265 17..303 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:42 Download gff for BO28839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3168335..3168437 304..408 98   Plus
arm_3L 3167979..3168265 17..303 100 -> Plus

BO28839.pep Sequence

Translation from 16 to 424

> BO28839.pep
MSKPGSAPPQFTYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTI
VTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG
CCLIPCCIDDCMDVHHSCPNCRAYLGRYRRASFLDH

BO28839.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-PD 130 CG32280-PD 1..130 1..130 728 100 Plus
CG32280-PC 130 CG32280-PC 1..130 1..130 728 100 Plus
CG32280-PB 130 CG32280-PB 1..130 1..130 728 100 Plus
CG32280-PA 130 CG32280-PA 1..130 1..130 728 100 Plus
CG13510-PC 129 CG13510-PC 6..127 15..128 217 36.6 Plus