Clone BO28858 Report

Search the DGRC for BO28858

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG11381-RA
Protein status:BO28858.pep: Imported from assembly
Sequenced Size:1342

Clone Sequence Records

BO28858.complete Sequence

1342 bp assembled on 2011-08-24

GenBank Submission: KX797770

> BO28858.complete
GAAGTTATCAGTCGACATGCTCAAAGCCGCAAAGATCCCCTTGTTCTTCG
CCCTTTTGGGTGCTGTGTGTATCCAGGCCGTCGTGGTTGGTCCCCAGCCA
TTGCATAATAACAACAGGAACGGCTACCGCTACAATGGCCCCGCCCACAA
GTATCTCCCATCGGAGGAGTCGCACTCGCACGGCAGCCCCTTGGATTCGA
GTCACCAGCATGATCAGCAGGGCCCCAGTAATGCCTACAACTCACATCAT
TACCCAGCACAGGAGCAACATGGCCAGGGAGCGCCGGAGCACGACCATCA
GCAGAAGGAGGTTGACTCCTGGCAAACGGCTCTTTCCCAGCAGCAACACG
AGAGCTTCGGAAACCAGCAAAATCATCAGAACGCCTACAATGAAGGACCT
GTGTACCAGCACTATCAGGGATTTAACCACCAACAACATTATGGATTAAG
CCAACAGCAACAGCATGAAAGCTACGGGCAGGAACACTATCAACAGAGCC
CCAACCAGCTGCAACACCATCAGTCCCAACACGCAAACGAATATGCCTAC
GAACCAGCTCATTTCCAGCAGCAACAGCAGCATCACGAAATTCAGGGTCA
CAAGCAGCATCAGCAGAGGAAAGAGCACTGGAACTTCGTTCAAGAGCAGC
AACCCCAAAATCACGAACCCTGGCAATCTTCGCATGGCTTCCAACAGCAC
CAGCAGCAGCATTCCAATCGCTTTGAGTCACAGCTTCCGCTGCGGGAAGA
CCTTTGGCAACCCATTCGTGAGCTGGACCTAGAGAAGCTTCCTTCGGCTG
AGGCGCACGCCAGTAGCCACAAGACAGTTGCAGCTCCTGGACGAGATGTA
AAGCTCGTGCCCAGTTACACGCTCTCCAGCGACTTTGAGCACGACCGCTT
CATCGGACTGGATAGTACGGACACTCGTCTGCTGACCCAATCTCTGCCAG
ATGCCTACCGGAAACAGCTGTTCTCCTCGCCACCAGAACCATCGTCTTTA
GCCCAGGGACATAACCAGCAACACAAGCCCGGATCCGCAGCCTATGGTGG
TTCCCACGGACCATCCCTTGGCGAATCCACATCCGATTTCCTGCAAATGC
AGTCCCACTCGTATCAGCTGCCTTCAACGTTTACTACTCACACGGAATGG
ACCCAGGACAAGGAGCAGCATCAGCACAATCCCCAGCAGCAGGCCACCGG
CAATCGTCAGTACTCGGCTAGTGCCTTCGCAGTGTCCCCTTCGTATCTGC
ACGCCTCCGAAGCCTCCCAGCCGCCCAAGAACAGCTTGCCACATCCTAGC
CGTGACTTCCAGCCACCTTACTACGCAAGCTTTCTAGACCAT

BO28858.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-RA 1311 CG11381-PA 1..1308 17..1324 6540 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-RA 1603 CG11381-RA 86..1393 17..1324 6540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1203932..1205223 33..1324 6460 100 Plus
Blast to na_te.dros performed 2014-11-27 07:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6715..6920 445..653 234 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7002 426..711 212 59.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6964 483..729 212 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2464 566..711 202 63.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6861 563..711 199 63.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2544 452..662 198 61.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6918 504..711 198 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2308..2514 504..710 196 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2616 491..791 193 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2356..2687 426..742 193 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2372..2510 478..616 190 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..7012 338..589 182 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6756..7013 405..668 181 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2608 515..821 180 54.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6944 405..611 179 56.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2473 457..627 172 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6726..6951 363..585 168 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2647..2945 426..718 167 56.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6897 566..711 167 60.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6646..6880 483..712 165 56.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2440 571..711 142 58.2 Plus
roo 9092 roo DM_ROO 9092bp 1006..1150 453..589 139 60.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1373..1600 410..628 136 55 Plus
roo 9092 roo DM_ROO 9092bp 1059..1161 553..663 130 64.3 Plus

BO28858.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:13 Download gff for BO28858.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 84..1391 17..1326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:44 Download gff for BO28858.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 86..1393 17..1326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:07 Download gff for BO28858.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 86..1393 17..1326 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:07 Download gff for BO28858.complete
Subject Subject Range Query Range Percent Splice Strand
X 1203934..1205223 35..1326 99   Plus
X 1203862..1203879 17..34 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:44 Download gff for BO28858.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1097967..1099256 35..1326 99   Plus
arm_X 1097895..1097912 17..34 100 -> Plus

BO28858.pep Sequence

Translation from 16 to 1342

> BO28858.pep
MLKAAKIPLFFALLGAVCIQAVVVGPQPLHNNNRNGYRYNGPAHKYLPSE
ESHSHGSPLDSSHQHDQQGPSNAYNSHHYPAQEQHGQGAPEHDHQQKEVD
SWQTALSQQQHESFGNQQNHQNAYNEGPVYQHYQGFNHQQHYGLSQQQQH
ESYGQEHYQQSPNQLQHHQSQHANEYAYEPAHFQQQQQHHEIQGHKQHQQ
RKEHWNFVQEQQPQNHEPWQSSHGFQQHQQQHSNRFESQLPLREDLWQPI
RELDLEKLPSAEAHASSHKTVAAPGRDVKLVPSYTLSSDFEHDRFIGLDS
TDTRLLTQSLPDAYRKQLFSSPPEPSSLAQGHNQQHKPGSAAYGGSHGPS
LGESTSDFLQMQSHSYQLPSTFTTHTEWTQDKEQHQHNPQQQATGNRQYS
ASAFAVSPSYLHASEASQPPKNSLPHPSRDFQPPYYASFLDH

BO28858.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-PA 436 CG11381-PA 1..436 1..436 2407 100 Plus
Smr-PF 3601 CG4013-PF 4..291 16..283 213 24.6 Plus
Smr-PE 3601 CG4013-PE 4..291 16..283 213 24.6 Plus
Smr-PD 3601 CG4013-PD 4..291 16..283 213 24.6 Plus
Smr-PG 3607 CG4013-PG 4..297 16..283 202 23.9 Plus