Clone BO28862 Report

Search the DGRC for BO28862

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptEla-RB
Protein status:BO28862.pep: Imported from assembly
Sequenced Size:961

Clone Sequence Records

BO28862.complete Sequence

961 bp assembled on 2011-08-25

GenBank Submission: KX798686

> BO28862.complete
GAAGTTATCAGTCGACATGTTAAGCAGGAGGGTCATCGCATTCGCCGCTC
TGGCCCTCATCCAGATAGCCAGCGGTCAGGCCTCGCAATTCAGCAGGGAC
GAAAGTCAGGAGGATCAGAAGACGGAGTTTAACCTGGCCTCCACTCTGAC
GGGAGGCATTACCAGCAGTCGCCATCGCCAGCGGGCCAATCTCAATTCGC
AACTTTATCCTGGCCTTGGTCAGCTGGGATCGGGTTATGCGGGCGCAACT
GGATCCATCGACGATGCCCATGGCCATGAGCAGGGTGGCTCTGGCGTACG
AGTGGCCAGAGGTCACCAGATTCCCGCTTATCCGCCTCCGGGTTTTCCTG
GACAACAGGCTCCAGTTCCGTACCCAGCTGCAGGAGGCTCTTCAGGAGGA
TCCTCATCATCCGGTGGTTACCAAAGTGCAGGTGCTGTTTCTCCTCCTGG
CTATCCTGTTGCTGGAGCAGTTCCTGCTCAGTATCCGGTGGGAGTTCCTC
CCCAGCAGCCAGTGGGTGCAGGAGCACCTGGTTACTTCCCGGGAACTGGT
GCCTATCCTGGCTATCCCTACCCCGGAGTATACTTGCCACAGTACCCAGC
GTACCCTCAACCAGCCCAGTTCCCCGCCTATGGAGTGCTACCCGGAGCTG
TGGCTCAACCAGGAGTTCCTGGAGTAGCTGGAGTTCCGGGAGCACCTGGA
GTGGCAGGAGTGCCCGGAGCAGCTGGTCAGGCTCCTGCCACCAGCGGCAT
GAACTATCATCGCTATCCGGCTCACAATCCCGCTGATCCGAGCCATTGGG
ACCATCATTTCTCGATGAACACCGAGTACAAGGAGGATGGCGTCCACAAG
GGACCATTTGGAGTGCTGAACAATCACAATGCCTTTGGCTATGGCAGTGG
ATATGGGGGCGGATACAACGGTGCCTTCAACTCGCCGGCCTACGCAAGCT
TTCTAGACCAT

BO28862.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-RB 930 CG7021-PB 1..927 17..943 4635 100 Plus
Ela-RC 990 CG7021-PC 353..987 309..943 3175 100 Plus
Ela-RA 990 CG7021-PA 353..987 309..943 3175 100 Plus
Ela-RC 990 CG7021-PC 1..293 17..309 1465 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-RB 1127 CG7021-RB 20..954 16..950 4645 99.8 Plus
Ela-RC 2135 CG7021-RC 373..1014 309..950 3180 99.7 Plus
Ela-RA 1187 CG7021-RA 373..1014 309..950 3180 99.7 Plus
Ela-RC 2135 CG7021-RC 20..313 16..309 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24866010..24866530 430..950 2575 99.6 Plus
3R 32079331 3R 24865369..24865662 16..309 1470 100 Plus
3R 32079331 3R 24865722..24865846 309..433 625 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:52:22 has no hits.

BO28862.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 13:53:04 Download gff for BO28862.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 25..946 22..945 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:39:27 Download gff for BO28862.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 26..947 22..945 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:44:40 Download gff for BO28862.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 26..947 22..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:44:40 Download gff for BO28862.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24866012..24866523 432..945 99   Plus
3R 24865722..24865844 309..431 100 -> Plus
3R 24865375..24865661 22..308 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:39:27 Download gff for BO28862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20691734..20692245 432..945 99   Plus
arm_3R 20691444..20691566 309..431 100 -> Plus
arm_3R 20691097..20691383 22..308 100 -> Plus

BO28862.pep Sequence

Translation from 16 to 961

> BO28862.pep
MLSRRVIAFAALALIQIASGQASQFSRDESQEDQKTEFNLASTLTGGITS
SRHRQRANLNSQLYPGLGQLGSGYAGATGSIDDAHGHEQGGSGVRVARGH
QIPAYPPPGFPGQQAPVPYPAAGGSSGGSSSSGGYQSAGAVSPPGYPVAG
AVPAQYPVGVPPQQPVGAGAPGYFPGTGAYPGYPYPGVYLPQYPAYPQPA
QFPAYGVLPGAVAQPGVPGVAGVPGAPGVAGVPGAAGQAPATSGMNYHRY
PAHNPADPSHWDHHFSMNTEYKEDGVHKGPFGVLNNHNAFGYGSGYGGGY
NGAFNSPAYASFLDH

BO28862.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-PB 309 CG7021-PB 1..309 1..309 1684 100 Plus
Ela-PC 329 CG7021-PC 1..329 1..309 1647 93.6 Plus
Ela-PA 329 CG7021-PA 1..329 1..309 1647 93.6 Plus
Cpr47Ef-PD 601 CG13214-PD 356..548 66..250 175 34.4 Plus
Cpr47Ef-PC 612 CG13214-PC 356..559 66..250 166 33.3 Plus