Clone BO28863 Report

Search the DGRC for BO28863

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptCG6933-RC
Protein status:BO28863.pep: Imported from assembly
Sequenced Size:1123

Clone Sequence Records

BO28863.complete Sequence

1123 bp assembled on 2011-08-24

GenBank Submission: KX797501

> BO28863.complete
GAAGTTATCAGTCGACATGGGAGGTACGTTGGCTCGAAGAACGGATACAG
TTATCTCAGCAATCAATATGAGGATCTGTGTCGTGGCCGCATGTCTCCTA
ATGGCATCGCAGGCCACCGGCTACACGATGGATGATCTGTGCCAACAGTG
GTCGGGCTATGGATACATCGGCAATCCGAGCAACTGCCATGCCTGGGGAT
ACTGCAAGAACCAGGAGGTTGTGGCCTGGGGCACCTGTCCCAACGGCTTG
GTGTTCAACGCGCAGGCCGGCAGCTGTGATTACGCTAATACCACGGTGTG
CTCCACCAGTGCCGTTGAGACATGCTCCAACGTCAAATCTCCCATGTATG
TGGCCAATCCGTTGAACTGCACCGAATACGCCTACTGCGATGGCACAGGC
CAAATCTCCTATGGCGATTGCGGCACCGGCGGCGTCTATTCGGCATCCTC
CACAAAATGTATATGGGGACCCGCCTGCCCGCAGGACACCATCTGTCGGT
TCATGTTGTCCAACATCTTTGTAGGCGATCCGAACCAGTGCGGCAACTAC
ATCAACTGCGTCAACGGCTATGGCACTTCCGAAAAATGTTCCAGCACCGC
CAATCCCTACTATAATAAAGCCACTGGCAACTGCCAGTCGACGAATCCGT
GCACCGGCGAAGATTCAAACAGTGGAAACTCTGACCAGTTCACTGTTGGG
CAAACAAATGCAACTGCTTGTGACGAAGAAGCTTTTAAAGCAGCAGATCC
ACTTACTGTAAATGGGGAATCTGTTGACTATAGGTACGTTTCTGATGGTG
TCACCTGCTATGGGTACTACTACTGTGCAGCAGTAAACGCCACTGGCTAT
TGGAACCAATGTCCCACCGGTACCCAATTCAATGCTGGCAAGTGCGTTTC
GCCAGCCTCCTTTGTCTGTACCCATAACCGATGTGGGAACGTTAACAATC
CATTCATGGCAGATGAGGGTTGCAAGAACTACACAATCTGCTCCAGCGGA
ATAACCGGATCATGTCCCACCAATGCGCCGTACTACGACGAGGTGAACAA
TATCTGCACCACCAAAATTCCCGATTACGCCATTTGTAATTCGACGGCTA
GTACAGCAAGCTTTCTAGACCAT

BO28863.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-RD 1092 CG6933-PD 1..1089 17..1105 5445 100 Plus
CG6933-RC 1092 CG6933-PC 1..1089 17..1105 5445 100 Plus
CG6933-RE 1056 CG6933-PE 6..1053 58..1105 5240 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-RD 1413 CG6933-RD 209..1297 17..1105 5445 100 Plus
CG6933-RC 1283 CG6933-RC 79..1167 17..1105 5445 100 Plus
CG6933-RE 1377 CG6933-RE 214..1261 58..1105 5240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20218618..20219665 1105..58 5240 100 Minus
3L 28110227 3L 20220061..20220103 59..17 215 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:04:21 has no hits.

BO28863.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:09 Download gff for BO28863.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 79..1167 17..1107 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:10 Download gff for BO28863.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 79..1167 17..1107 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:16 Download gff for BO28863.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 79..1167 17..1107 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:16 Download gff for BO28863.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20220061..20220103 17..59 100   Minus
3L 20218615..20219663 60..1107 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:10 Download gff for BO28863.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20213161..20213203 17..59 100   Minus
arm_3L 20211715..20212763 60..1107 99 <- Minus

BO28863.pep Sequence

Translation from 16 to 1123

> BO28863.pep
MGGTLARRTDTVISAINMRICVVAACLLMASQATGYTMDDLCQQWSGYGY
IGNPSNCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVCSTSAV
ETCSNVKSPMYVANPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIW
GPACPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTANPYYN
KATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNG
ESVDYRYVSDGVTCYGYYYCAAVNATGYWNQCPTGTQFNAGKCVSPASFV
CTHNRCGNVNNPFMADEGCKNYTICSSGITGSCPTNAPYYDEVNNICTTK
IPDYAICNSTASTASFLDH

BO28863.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-PD 363 CG6933-PD 1..363 1..363 2049 100 Plus
CG6933-PC 363 CG6933-PC 1..363 1..363 2049 100 Plus
CG6933-PE 351 CG6933-PE 1..351 13..363 1982 99.4 Plus
CG6933-PB 351 CG6933-PB 1..351 13..363 1982 99.4 Plus
CG6933-PA 351 CG6933-PA 1..351 13..363 1982 99.4 Plus