Clone BO28864 Report

Search the DGRC for BO28864

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:64
Vector:pDNR-Dual
Associated Gene/Transcriptpip-RK
Protein status:BO28864.pep: Imported from assembly
Sequenced Size:1252

Clone Sequence Records

BO28864.complete Sequence

1252 bp assembled on 2011-08-25

GenBank Submission: KX796957

> BO28864.complete
GAAGTTATCAGTCGACATGTCTCTGAACGCCGAGCGATCGTACAAAATGA
AACTGCGCGATGTGGAAAATGCCTTCAAATACCGGCGCATACCGTATCCC
AAGCGTTCCGTCGAGCTGATCGCCCTGCTGGCTATTTCGTGCACCTTCTT
CCTGTTCATGCACACCAACAAACTGAACAGTCGCCTCAAGGAGATGGAGG
TGAAGCTGCAGCCATCGGAGTTTTCGGCCCTCGGTCTAACGGGCAACCAC
ATCAGCGGACACGATGCGGGCAAGCACGATGACATCAACACCCTGCACGG
CACCTACCAATATCTGAAGAGCACTGGCCAGCTAAAACACCTGACCACCG
CCCAGCTAAACAACACTCCTCGCGCCCAAGTGGACACGCTGTTCTTCAAT
CGGATCACCAAGACCGGCAGCGAGAAGATGATGGAGTTGCTCAAGATCCT
GGGCAAGCGCCACAACTTTGAGGCGCGTCGCGATGTTGAGGGATTCTACG
AAGTAGTCATCATGCATGACGCCTTCGCCAAAAACTTTATCCGCACCGAG
GTACTCAACTGCACCAAAGCCAATAGCTATACGAAGCACGTAGCCTTCCT
GGACTTCGATCTACTGGACGAACCCTGGCCCATATACATCAATATGGTGC
GAGATCCCATCGAGCGGCTGGTCAGCTGGTTCTACTATGTCCGCGCCCCC
TGGCATTTCGCCGAGAGAAAGGAAATGTTCGGGGATGCCATCGTACTGCC
TAGCATAGATTGGCTCAGGAAGGACTTTAACCGCTGCATCGAGGAACGCG
ATCCCGAGTGTGTGTACGAGCAAATGGAAATGGGCAATCTGGGCGATCAT
AGGCGGCAGTCACTGTATCTCTGCGGTCAGAACATGGCGGTGTGCATGCC
CTTCAACTCCCATGAGGCCATGCAGCGGGCCAAGAAGAATGTGGAGGAGC
ACTACGCAGTGGTGGGAACCTGGGAGGATACGAACACCACGTTGTCGGTT
CTCGAGGGTTATATACCACGGTTCTTCAGTGGGGCCAAGGACCAGTACTA
CGCGTTGAGGAAAAGTTTGGGAAACTATAACAGGAATACCTACAGACCCA
GTCTCAGTGACAAGGCAAGGGCCGTACTCAGCCAGAACCTCACCCGGGAA
ATCGAGTTGTATCAGTTCGTCAGGCACCGGCTGTACAAGCAGTATATAGC
CCTAAAGCTCGAAGAAGATCCCAAGCTGTGGGATGCAAGCTTTCTAGACC
AT

BO28864.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RK 1221 CG9614-PK 1..1218 17..1234 6090 100 Plus
pip-RM 879 CG9614-PM 1..317 17..333 1585 100 Plus
pip-RJ 1206 CG9614-PJ 1..317 17..333 1585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RK 1478 CG9614-RK 180..1397 17..1234 6090 100 Plus
pip-RM 2975 CG9614-RM 180..496 17..333 1585 100 Plus
pip-RJ 1490 CG9614-RJ 180..496 17..333 1585 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19311618..19312187 898..329 2850 100 Minus
3L 28110227 3L 19310975..19311316 1234..893 1695 99.7 Minus
3L 28110227 3L 19318784..19318951 272..105 840 100 Minus
3L 28110227 3L 19337342..19337430 105..17 445 100 Minus
3L 28110227 3L 19313152..19313214 335..273 300 98.4 Minus
Blast to na_te.dros performed on 2014-11-26 21:53:26 has no hits.

BO28864.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:04:33 Download gff for BO28864.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 170..1387 17..1236 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:39:59 Download gff for BO28864.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 180..1397 17..1236 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:09 Download gff for BO28864.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 180..1397 17..1236 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:09 Download gff for BO28864.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19337342..19337430 17..105 100   Minus
3L 19318784..19318950 106..272 100 <- Minus
3L 19313156..19313214 273..331 100 <- Minus
3L 19311619..19312184 332..897 100 <- Minus
3L 19310971..19311311 898..1236 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:39:59 Download gff for BO28864.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19330442..19330530 17..105 100   Minus
arm_3L 19311884..19312050 106..272 100 <- Minus
arm_3L 19306256..19306314 273..331 100 <- Minus
arm_3L 19304719..19305284 332..897 100 <- Minus
arm_3L 19304071..19304411 898..1236 99 <- Minus

BO28864.pep Sequence

Translation from 16 to 1252

> BO28864.pep
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLKHLTTAQLNNTPRAQVDTLFFNRITKTGSEKMMELLKILGKRHN
FEARRDVEGFYEVVIMHDAFAKNFIRTEVLNCTKANSYTKHVAFLDFDLL
DEPWPIYINMVRDPIERLVSWFYYVRAPWHFAERKEMFGDAIVLPSIDWL
RKDFNRCIEERDPECVYEQMEMGNLGDHRRQSLYLCGQNMAVCMPFNSHE
AMQRAKKNVEEHYAVVGTWEDTNTTLSVLEGYIPRFFSGAKDQYYALRKS
LGNYNRNTYRPSLSDKARAVLSQNLTREIELYQFVRHRLYKQYIALKLEE
DPKLWDASFLDH

BO28864.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PK 406 CG9614-PK 1..406 1..406 2158 100 Plus
pip-PA 413 CG9614-PA 1..398 1..400 1231 59.6 Plus
pip-PD 418 CG9614-PD 1..397 1..400 1203 57.6 Plus
pip-PG 407 CG9614-PG 1..399 1..400 1139 56.7 Plus
pip-PH 405 CG9614-PH 1..402 1..404 1126 56.5 Plus