Clone BO28865 Report

Search the DGRC for BO28865

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptPu-RC
Protein status:BO28865.pep: Imported from assembly
Sequenced Size:958

Clone Sequence Records

BO28865.complete Sequence

958 bp assembled on 2011-08-24

GenBank Submission: KX794130

> BO28865.complete
GAAGTTATCAGTCGACATGAGCTTTACCCGCCAACTGTCCGAGATGAGTG
CCAGCGAGCTGAACGATGCCATCGACGACACCAACTTCCCGCAGGCCCAC
ATCCTTTCGCGCGGACGCAACAACAGCGTCTGCTCAACAAGTAGCACCTC
GGGCACCTCCTCGCTGGCGGACAGGCAGCAGAACCAGGCGGAGGAGGCCA
CTGCCATTGCGGGCACACCCGTCGAGGAGGTGGCGCCAGCTCCTGCTCTC
GTCCCGTTGGCCGGCAACCAGAGACCCCGCCTCATCCTGAAGACCAACGG
CAGCAGTCCGGATAGTGATGGCCACGAGAAGTGCACGTTCCACCACGACC
TGGAGCTGGACCACAAGCCGCCGACGCGAGAGGCCCTCCTTCCGGACATG
GCACGCTCGTATCGTCTACTCTTGGGCGGCCTGGGCGAGAATCCCGATCG
CCAGGGACTGATCAAGACGCCGGAGCGGGCAGCCAAGGCCATGCTGTACT
TCACCAAGGGCTACGACCAGAGTCTCGAGGATGTTCTCAATGGCGCCGTT
TTCGACGAGGATCATGACGAAATGGTGGTGGTCAAGGATATTGAAATGTT
CTCCATGTGCGAGCATCATCTGGTGCCCTTCTACGGCAAAGTTTCCATCG
GTTATTTGCCGTGCAACAAGATTCTCGGACTCAGTAAATTGGCACGCATT
GTCGAAATATTTTCGCGTCGCCTGCAAGTCCAGGAGCGCTTAACTAAGCA
GATCGCAGTGGCCGTGACTCAGGCCGTGCAACCCGCTGGAGTAGCAGTGG
TCGTAGAGGGAGTCCACATGTGCATGGTGATGCGTGGCGTGCAGAAGATC
AACAGCAAAACTGTTACCTCAACTATGCTGGGCGTGTTCCGAGACGATCC
CAAGACCCGTGAGGAATTCCTGAACTTAGTCAATAGCAAAGCAAGCTTTC
TAGACCAT

BO28865.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RC 927 CG9441-PC 1..924 17..940 4620 100 Plus
Pu-RA 975 CG9441-PA 352..972 320..940 3105 100 Plus
Pu-RB 822 CG9441-PB 199..819 320..940 3105 100 Plus
Pu-RA 975 CG9441-PA 1..305 17..321 1525 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RC 1744 CG9441-RC 174..1098 16..940 4625 100 Plus
Pu-RA 1793 CG9441-RA 527..1147 320..940 3105 100 Plus
Pu-RB 1625 CG9441-RB 359..979 320..940 3105 100 Plus
Pu-RA 1793 CG9441-RA 175..480 16..321 1530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21179292..21179597 16..321 1530 100 Plus
2R 25286936 2R 21179937..21180147 320..530 1055 100 Plus
2R 25286936 2R 21181419..21181585 530..696 835 100 Plus
2R 25286936 2R 21181836..21181962 814..940 635 100 Plus
2R 25286936 2R 21181644..21181761 696..813 590 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:05:22 has no hits.

BO28865.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:10 Download gff for BO28865.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 175..1098 17..942 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:47 Download gff for BO28865.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 175..1098 17..942 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:39 Download gff for BO28865.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 175..1098 17..942 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:39 Download gff for BO28865.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21181836..21181962 814..942 98   Plus
2R 21181645..21181761 697..813 100 -> Plus
2R 21181420..21181585 531..696 100 -> Plus
2R 21179938..21180147 321..530 100 -> Plus
2R 21179293..21179596 17..320 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:47 Download gff for BO28865.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17069341..17069467 814..942 98   Plus
arm_2R 17069150..17069266 697..813 100 -> Plus
arm_2R 17068925..17069090 531..696 100 -> Plus
arm_2R 17067443..17067652 321..530 100 -> Plus
arm_2R 17066798..17067101 17..320 100 -> Plus

BO28865.pep Sequence

Translation from 16 to 958

> BO28865.pep
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSL
ADRQQNQAEEATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDS
DGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIK
TPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEH
HLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAV
TQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREE
FLNLVNSKASFLDH

BO28865.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PC 308 CG9441-PC 1..308 1..308 1573 100 Plus
Pu-PA 324 CG9441-PA 1..324 1..308 1546 95.1 Plus
Pu-PB 273 CG9441-PB 18..273 58..308 1088 85.2 Plus