Clone BO28866 Report

Search the DGRC for BO28866

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:66
Vector:pDNR-Dual
Associated Gene/Transcriptcav-RE
Protein status:BO28866.pep: Imported from assembly
Sequenced Size:1063

Clone Sequence Records

BO28866.complete Sequence

1063 bp assembled on 2011-08-24

GenBank Submission: KX796198

> BO28866.complete
GAAGTTATCAGTCGACATGGTCAAAGAGGTTAATATGTCGGGGACGCAAA
TGTCTGCCTTCCTGAGAAAGTATCTAGCCGACGAGGACAAAAAAATTCGT
GCGCAATTCAAAGAAAGCGATCCTAACAACAAATTGATTCTATGGATGCA
CGAAAAAACGAGAATAACCGAGGAGGACTTGGCACGCCCATACACCGAGG
ACGAGGTAAAGGAGCTTTGTCTACGCACCAAAGTGAAGGTTGATATGACC
GCTTGGAATTGTCTGTGGGAAGCCAAAAAGAGGTTTGAAGCAAAAGGACG
TTTTGTGAACAAGTCTGAGAGATTCATCAACCGAATGTATATGAAAGCGG
TGCGCAGAAAGATGGTCCAACCGTATCCGGAGGAGTTTGTGGCCCAGCGA
AGAGAAATAGTTGCAGCCGAGACTAAGAAGCAGAACATCAGCCGATTGGA
TAGATGGCAAAAGAAAAAGAGTCAAAACCTATCAGCACCAGAATCCTCTC
CAGACGCTCATGCATCTTCTAATGACGCGGTGCAGAGCCACGAGGACCAA
GCAAACACAAATCTTAGTTCACTGTCTCAAATGAACTTTCAAGTGGAAGC
GATGGCTCCGCCAGGCGTGTCGTCATCTGATCTTAGCGGCATCGGAGACG
ATGAGGACGAACAGCAGCAGTCAGGATTTCAGGATGAGAACATCAACCGT
CCAGAGACAGAGATTAATGAGAATTCGGTGAGATGTGATCCAATTAATTT
AGGAAGGATGCGGACTGGATGTATAAATTCGCAAGCAAATAACAGTTTCC
GGAATACGGAGTCTGATCCGGACTACTATATGTTTGGCACCCAATTGAGC
ACATTAGTACGACCCACGTCGACTCAAGAGCCTGACGATCAGGTAAACTG
TCCAGAGACAGAGATGAATGAGAGCTGGGTAAGGTGTGATCAAATTAATT
CGGAAAGCTTGTCGATTGGACCGTCAATTGATTCGGAAGGAACTATCACT
TTTCAAAATACAGAATCTGAGCCGATCGACGTCACCTCAATAGCCGCAAG
CTTTCTAGACCAT

BO28866.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
cav-RE 1032 CG6219-PE 1..1029 17..1045 5145 100 Plus
cav-RA 1038 CG6219-PA 19..1035 29..1045 5085 100 Plus
cav-RB 1014 CG6219-PB 1..1011 35..1045 5055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
cav-RE 1776 CG6219-RE 640..1668 17..1045 5145 100 Plus
cav-RB 1226 CG6219-RB 96..1118 23..1045 5100 99.9 Plus
cav-RA 1520 CG6219-RA 396..1412 29..1045 5085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24222535..24223420 160..1045 4430 100 Plus
3R 32079331 3R 24222337..24222474 23..160 675 99.3 Plus
Blast to na_te.dros performed on 2014-11-27 07:06:32 has no hits.

BO28866.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:11 Download gff for BO28866.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 601..1629 17..1047 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:25 Download gff for BO28866.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 640..1668 17..1047 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:07 Download gff for BO28866.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 640..1668 17..1047 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:07 Download gff for BO28866.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24222536..24223420 161..1047 99   Plus
3R 24222337..24222474 23..160 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:25 Download gff for BO28866.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20048258..20049142 161..1047 99   Plus
arm_3R 20048059..20048196 23..160 99 -> Plus

BO28866.pep Sequence

Translation from 16 to 1063

> BO28866.pep
MVKEVNMSGTQMSAFLRKYLADEDKKIRAQFKESDPNNKLILWMHEKTRI
TEEDLARPYTEDEVKELCLRTKVKVDMTAWNCLWEAKKRFEAKGRFVNKS
ERFINRMYMKAVRRKMVQPYPEEFVAQRREIVAAETKKQNISRLDRWQKK
KSQNLSAPESSPDAHASSNDAVQSHEDQANTNLSSLSQMNFQVEAMAPPG
VSSSDLSGIGDDEDEQQQSGFQDENINRPETEINENSVRCDPINLGRMRT
GCINSQANNSFRNTESDPDYYMFGTQLSTLVRPTSTQEPDDQVNCPETEM
NESWVRCDQINSESLSIGPSIDSEGTITFQNTESEPIDVTSIAASFLDH

BO28866.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
cav-PE 343 CG6219-PE 1..343 1..343 1786 100 Plus
cav-PA 345 CG6219-PA 7..345 5..343 1767 100 Plus
cav-PB 337 CG6219-PB 1..337 7..343 1757 100 Plus
cav-PD 337 CG6219-PD 1..337 7..343 1757 100 Plus