Clone BO28868 Report

Search the DGRC for BO28868

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG3038-RB
Protein status:BO28868.pep: Imported from assembly
Sequenced Size:1108

Clone Sequence Records

BO28868.complete Sequence

1108 bp assembled on 2011-08-24

GenBank Submission: KX795173

> BO28868.complete
GAAGTTATCAGTCGACATGGATTCAAGCCAGTCCCGCAAAAACGGTTTCT
TGCTGCACTTACCACTCGAAACGAAGAGGAATCCATCTAACCCTAATACT
CCGTTAAGTAATCTTCTGAATCTCACGGACTTCCACTACTTGCTGGCCAG
TAATGTGTGTCGAAAGGCAAAAAGAGAACTCTTAGCCGTTTTAATAGTTA
CTTCGTATGCCGGACACGATGCCTTGCGATCAGCTCACCGACAGGCAATT
CCCCAAAGCAAACTGGAAGAAATGGGCCTGCGAAGAGTTTTTCTCTTGGC
AGCCCTGCCTTCAAGAGAGCATTTTATAAGCCAGGATCAACTGGCCAGCG
AACAGAATCGTTTCGGGGACCTTCTCCAGGGGAATTTCATCGAGGACTAT
CGCAATCTGAGCTACAAACACGTAATGGGATTAAAGTGGGTCTCTGAGGA
GTGCAAAAAGCAGGCCAAGTTTATCATTAAACTGGATGATGACATCATTT
ACGATGTGTTTCATCTGCGCAGGTATTTAGAGACCCTCGAGGTGCGCGAA
CCTGGACTGGCCACATCAAGTACTTTGTTATCTGGCTACGTACTGGATGC
CAAGCCCCCCATTCGCCTTCGAGCCAATAAGTGGTACGTTAGCAAAAAGG
AGTATCCTCAGGCTTTATATCCCGCCTATTTGTCGGGCTGGCTTTACGTG
ACCAACGTGCCAACAGCCGAGAGGATTGTGGCGGAGGCGGAGAGGATGTC
ATTTTTTTGGATCGATGACACCTGGTTGACTGGAGTAGTAAGGACTCGTT
TGGGTATTCCCCTTGAGCGTCACAACGACTGGTTTTCTGCCAATGCAGAG
TTCATCGACTGCTGTGTGCGAGATCTCAAGAAGCACAACTATGAGTGCGA
GTACTCCGTGGGACCCAATGGCGGTGACGACCGACTACTGGTGGAATTTC
TGCATAACGTTGAGAAGTGCTACTTTGATGAATGCGTCAAACGGCCGGTT
GGTAAGTCGCTCAAAGAGACCTGTTTAGCGGCGGCCAAATCTCGACCCCC
TAAACATGGTTTTCCTGAAATAAAAGCGTTGCGACTCAGGGCAAGCTTTC
TAGACCAT

BO28868.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-RB 1077 CG3038-PB 1..1074 17..1090 5370 100 Plus
CG3038-RA 1167 CG3038-PA 93..1164 19..1090 5360 100 Plus
CG3038-RC 1080 CG3038-PC 510..1077 523..1090 2840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-RB 1630 CG3038-RB 176..1249 17..1090 5370 100 Plus
CG3038-RA 1731 CG3038-RA 279..1350 19..1090 5360 100 Plus
CG3038-RC 1751 CG3038-RC 696..1263 523..1090 2840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 244442..245350 1090..182 4545 100 Minus
X 23542271 X 245412..245578 185..19 835 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:07:02 has no hits.

BO28868.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:12 Download gff for BO28868.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 162..1235 17..1092 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:43 Download gff for BO28868.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 176..1249 17..1092 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:22 Download gff for BO28868.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 176..1249 17..1092 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:22 Download gff for BO28868.complete
Subject Subject Range Query Range Percent Splice Strand
X 245412..245580 17..185 99   Minus
X 244438..245346 186..1092 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:43 Download gff for BO28868.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 139445..139613 17..185 99   Minus
arm_X 138471..139379 186..1092 99 <- Minus

BO28868.pep Sequence

Translation from 16 to 1108

> BO28868.pep
MDSSQSRKNGFLLHLPLETKRNPSNPNTPLSNLLNLTDFHYLLASNVCRK
AKRELLAVLIVTSYAGHDALRSAHRQAIPQSKLEEMGLRRVFLLAALPSR
EHFISQDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLKWVSEECKKQA
KFIIKLDDDIIYDVFHLRRYLETLEVREPGLATSSTLLSGYVLDAKPPIR
LRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAEAERMSFFWID
DTWLTGVVRTRLGIPLERHNDWFSANAEFIDCCVRDLKKHNYECEYSVGP
NGGDDRLLVEFLHNVEKCYFDECVKRPVGKSLKETCLAAAKSRPPKHGFP
EIKALRLRASFLDH

BO28868.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-PB 358 CG3038-PB 1..358 1..358 1893 100 Plus
CG3038-PA 388 CG3038-PA 32..388 2..358 1888 100 Plus
CG3038-PC 359 CG3038-PC 32..359 2..358 1692 91.9 Plus
CG11357-PD 434 CG11357-PD 99..341 16..263 319 30.3 Plus
CG11357-PC 434 CG11357-PC 99..341 16..263 319 30.3 Plus