Clone BO28872 Report

Search the DGRC for BO28872

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptTraf-like-RA
Protein status:BO28872.pep: Imported from assembly
Sequenced Size:1456

Clone Sequence Records

BO28872.complete Sequence

1456 bp assembled on 2011-08-24

GenBank Submission: KX797043

> BO28872.complete
GAAGTTATCAGTCGACATGTCACTGACCAAGTCGTCGTCGAGAAAGGATC
TAACCGAGCAGAATCAGTATCAGAATCAGAATGAGAATCAGAATCAGCCC
AAATCGACGACCATAGTCAAGTATGAGAAGTCGTCGTGCCTCTTCTGCAA
CGAATGGTTCGATGCCCAGACATTCACGGAACACCTGATCCACTGCGGCC
AGGTGCTGGAGGAGTGTCCCAACGGCTGTCAGGCCTTCATTCCACGCATC
CGTATGCGATCCCATCTGAAGGAGTGTCCACGCAACCAGCACAATCTGAG
CAATCAGCAACGCATGAGTGTCAGCATGGATCGCCTGGATAGGCAGTCGG
ATCAGCGTCTCCTGGTCATTGAACAGGACGTGGGCACCATTCGGTCCGTT
CTCAACGAGGAGATACGACAGCGTTTGCATCTCATTACCGATGTGGGCAA
CATACGGAAGCAGAACCAGGTCGTCGAGGACTGGACCCGCGAAACCGAGA
AGGCAATGGACGATCTGCGTCGCCAGATGGAGGAGGAAACCAATCGGAAG
GCATTCGCCATCGAACAGAACCAGCTGGATGTCCAGTACTGCTGTGATAT
CACACAGTCCTTGAAAGAGCAAGTGGAGTCCAGGCTGGATGAGGCCCAAA
AGCTGGTCAATCAGCTCTCGGCGGACGTGACCTATCACCAGAATCAGCTA
AACGACAATATCCTAAAGCTGGAGGAGCTGATCTTTGAGAACGAGCGGCT
CAACAGGGAGAAGTTCTTTCAGATCGAGGAGTTTCTGCAGCAGATCAATG
AGGACATCAAAACAAAGCTGGGCAACAGTGACTATGTGACGTCAAAGCAG
GCCACATTGGACTATGAGGTGAAGAATGTGAAGAACATTGTGTGCGAAAC
GGAGGAACGTTGCGATAAATTGGATCGAGCACTTCACCAGACCATGCAGA
ATATATCGGATTTGGAGACCCAAATGGCCATGCAGCAGCGGATTGCCAGT
GTCCAGAATATAAGGGGACACTTGATTTGGCGCATCAAGGATTACTCGAA
AAAACTGGAAGAGTCCAAGCAGTACGACACCATCCTCCATAGCGCCATGT
TCTCCAATAAAGCCTTTGGCTATGCTCTACGGCTGGATATATACTTGAAT
GGCAAGGGCACCTGGAAGGGCAGGAACATGATCGCCTGCTTGAACGTTCT
ATCCGGAGAGTACGATCCCCTTCTGGCCTGGCCATGCCGCCTTCAGGCCG
AGATCATCATCCGGGATCAGTGCACGAATGTGGCAGATGCCGAGGATTAT
GTGAAGACCATCTTTGTGCGCAAGAAGAGCGATGATTTTATCCAAAGCAA
CCAGTACTTCCATATACCACACAAGGTAATCACCAGTCGCAACTATCTTC
GCAACGATTCCATGTTCATCGAGGTTCGAGTTCTAAAAGCAAGCTTTCTA
GACCAT

BO28872.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-RA 1425 CG4394-PA 1..1422 17..1438 7110 100 Plus
Traf-like-RC 1359 CG4394-PC 96..1356 178..1438 6305 100 Plus
Traf-like-RE 1188 CG4394-PE 1..1185 254..1438 5925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-RA 2285 CG4394-RA 379..1800 17..1438 7110 100 Plus
Traf-like-RE 2275 CG4394-RE 530..1790 178..1438 6305 100 Plus
Traf-like-RD 1877 CG4394-RD 132..1392 178..1438 6305 100 Plus
Traf-like-RE 2275 CG4394-RE 379..482 17..120 520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16415656..16416085 178..607 2150 100 Plus
X 23542271 X 16416153..16416564 606..1017 2060 100 Plus
X 23542271 X 16416794..16417100 1132..1438 1535 100 Plus
X 23542271 X 16415424..16415586 17..179 815 100 Plus
X 23542271 X 16416618..16416734 1016..1132 585 100 Plus
Blast to na_te.dros performed 2014-11-27 07:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 8767..8857 716..806 113 58.2 Plus

BO28872.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:13 Download gff for BO28872.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 339..1756 17..1434 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:19 Download gff for BO28872.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 379..1796 17..1434 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:50 Download gff for BO28872.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 379..1796 17..1434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:50 Download gff for BO28872.complete
Subject Subject Range Query Range Percent Splice Strand
X 16416795..16417096 1133..1434 100   Plus
X 16416619..16416734 1017..1132 100 -> Plus
X 16416155..16416563 608..1016 100 -> Plus
X 16415657..16416085 179..607 100 -> Plus
X 16415424..16415585 17..178 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:19 Download gff for BO28872.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16310828..16311129 1133..1434 100   Plus
arm_X 16310652..16310767 1017..1132 100 -> Plus
arm_X 16310188..16310596 608..1016 100 -> Plus
arm_X 16309690..16310118 179..607 100 -> Plus
arm_X 16309457..16309618 17..178 100 -> Plus

BO28872.pep Sequence

Translation from 16 to 1456

> BO28872.pep
MSLTKSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYEKSSCLFCNEWFDA
QTFTEHLIHCGQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLSNQQRM
SVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQN
QVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLK
EQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKF
FQIEEFLQQINEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCD
KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEES
KQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYD
PLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSDDFIQSNQYFHI
PHKVITSRNYLRNDSMFIEVRVLKASFLDH

BO28872.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-PA 474 CG4394-PA 1..474 1..474 2470 100 Plus
Traf-like-PC 452 CG4394-PC 33..452 55..474 2182 100 Plus
Traf-like-PE 395 CG4394-PE 1..395 80..474 2038 100 Plus
Traf-like-PD 395 CG4394-PD 1..395 80..474 2038 100 Plus
Traf-like-PG 395 CG4394-PG 1..395 80..474 2038 100 Plus