Clone BO28886 Report

Search the DGRC for BO28886

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:288
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG3209-RC
Protein status:BO28886.pep: Imported from assembly
Sequenced Size:1411

Clone Sequence Records

BO28886.complete Sequence

1411 bp assembled on 2011-08-24

GenBank Submission: KX797613

> BO28886.complete
GAAGTTATCAGTCGACATGATCGCCGTGCTGTTGGACATATTCTGGATCC
CCATCGGGGGCTTCCTCTCATTTCTCATATTTATTTCCGCCATAAACAAA
TCAATCGGCGTCCGAAAAGCGTACGTGAACCTCCTCCTAAGGATATTCGA
GTATGGTCGAGTTAGTATAGAGACAGCATCCAAAGAAAACCAACACATTC
AAAATCCCAAGACTGACGACAAACAGGGAGTGCAACTAGTGGACGACGCC
GATTCCAAAGAAGGCACCAATGGAGCCACATTGATTACCAGGGACGCGGT
ACTCCTGCCCCAGCCACAGGAGCCCGCTCCAGAGAAGCCAGTTTCCTCCA
CAAAGGATGAAATCAATTTCGATTTTGAGAAATGCCTGGACTACGTAAAG
TCTGGCGTGGAGGCCATCATCGAGGACGATGTTACGTCGCGCTTCGAGGC
GGAGGAGCTCAAGAGCTGGAACATGCTGACACGCACCAATAGGCACTACG
AGTTCATTTCCTGGAAAATCACCTCCATCTGGGTGTTCGGCTTCTTCATC
CGCTACGTCATCCTGATGCCCCTCCGGGTATTGGTATGCTTCGTTGGTGT
TTTATTTGCAGTTTTATCAAGCTCCATTGTGGCTTGTTTACCTTTTCGAT
TTGTACGGCTTTCTCTAGCGAGCTTGTCATTCAAAATTACGTTCCGCCTT
ATTTCAAGTTCTATGTCCTCCTTTATCAAGTTCCACAATAAGCAATATAA
GCCCACAGTCTCTGGGTTCTGTGTAGCCAACCACACCTCTCCCTTGGATG
TGGCTATATTATCGACCGATTGTACCTACTCTTTGATTGGCCAACGCCAT
GGCGGCTTTTTGGGGGTGCTGCAACGAGCTCTGGCCCGCGCATCTCCCCA
CATTTGGTTTGAGCGCGGCGAGGCCAAGGATCGTCATTTGGTGGCCGAGC
GACTGAAGCAGCACGTGTCTGATCCGAACAACCCACCGATCCTTATCTTC
CCGGAGGGAACTTGCATCAACAACACGTCGGTCATGCAGTTCAAGAAGGG
CAGCTTCGAAGTTGGCGGCGTCATCTACCCGGTGGCCATTAAGTACGATC
CGAGGTTCGGCGACGCCTTCTGGAACAGCGCGAAGTACTCGATGATGCAG
TATCTGTACATGATGATGACCTCGTGGGCCATCGTGTGCGATGTGTGGTA
CCTGCCGCCGATGTACAGGCAGGAGGGAGAGTCGGCGATCGACTTCGCGA
ACCGCGTGAAGAGTGTCATCGCGAAGCAGGGAGGTTTGATTGATCTGGTC
TGGGACGGGCAGCTGAAGCGCATGAAGCCAAAGAAGGAGTGGAGGGAGAT
CCAGCAAGTCGAGTTTGCCAATCGGCTGAAGTCGGACTCCACCGCAAGCT
TTCTAGACCAT

BO28886.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-RC 1380 CG3209-PC 1..1377 17..1393 6885 100 Plus
CG3209-RD 1614 CG3209-PD 1..819 17..835 4095 100 Plus
CG3209-RB 1377 CG3209-PB 1..584 17..600 2920 100 Plus
CG3209-RD 1614 CG3209-PD 1042..1611 824..1393 2820 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-RC 1751 CG3209-RC 151..1527 17..1393 6885 100 Plus
CG3209-RD 1985 CG3209-RD 151..969 17..835 4095 100 Plus
CG3209-RB 1660 CG3209-RB 151..734 17..600 2920 100 Plus
CG3209-RD 1985 CG3209-RD 1192..1761 824..1393 2820 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24073028..24073328 1093..1393 1505 100 Plus
2R 25286936 2R 24072704..24072963 835..1094 1300 100 Plus
2R 25286936 2R 24069998..24070244 354..600 1235 100 Plus
2R 25286936 2R 24070768..24071004 599..835 1185 100 Plus
2R 25286936 2R 24069737..24069943 150..356 1035 100 Plus
2R 25286936 2R 24069200..24069334 17..151 675 100 Plus
X 23542271 X 20825153..20825296 986..1129 240 77.8 Plus
Blast to na_te.dros performed on 2014-11-27 07:10:01 has no hits.

BO28886.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:14 Download gff for BO28886.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 291..1667 17..1395 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:27 Download gff for BO28886.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 151..1527 17..1395 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:41 Download gff for BO28886.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 151..1527 17..1395 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:41 Download gff for BO28886.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24073028..24073328 1093..1395 99   Plus
2R 24072705..24072961 836..1092 100 -> Plus
2R 24070768..24071004 599..835 100 -> Plus
2R 24070000..24070242 356..598 100 -> Plus
2R 24069739..24069942 152..355 100 -> Plus
2R 24069200..24069334 17..151 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:27 Download gff for BO28886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19960551..19960851 1093..1395 99   Plus
arm_2R 19960228..19960484 836..1092 100 -> Plus
arm_2R 19958291..19958527 599..835 100 -> Plus
arm_2R 19957523..19957765 356..598 100 -> Plus
arm_2R 19957262..19957465 152..355 100 -> Plus
arm_2R 19956723..19956857 17..151 100 -> Plus

BO28886.pep Sequence

Translation from 16 to 1411

> BO28886.pep
MIAVLLDIFWIPIGGFLSFLIFISAINKSIGVRKAYVNLLLRIFEYGRVS
IETASKENQHIQNPKTDDKQGVQLVDDADSKEGTNGATLITRDAVLLPQP
QEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKS
WNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVLFAVL
SSSIVACLPFRFVRLSLASLSFKITFRLISSSMSSFIKFHNKQYKPTVSG
FCVANHTSPLDVAILSTDCTYSLIGQRHGGFLGVLQRALARASPHIWFER
GEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVG
GVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMY
RQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEF
ANRLKSDSTASFLDH

BO28886.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-PC 459 CG3209-PC 1..459 1..459 2393 100 Plus
CG3209-PB 458 CG3209-PB 1..458 1..459 2133 89.3 Plus
CG3209-PD 537 CG3209-PD 1..274 1..274 1398 99.6 Plus
CG3209-PD 537 CG3209-PD 305..537 226..459 1134 90.6 Plus
CG3209-PE 380 CG3209-PE 1..195 1..195 1004 99.5 Plus
CG3209-PE 380 CG3209-PE 195..380 274..459 998 100 Plus
CG15450-PA 407 CG15450-PA 75..407 113..443 848 45.8 Plus