Clone BO28902 Report

Search the DGRC for BO28902

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG8197-RA
Protein status:BO28902.pep: Imported from assembly
Sequenced Size:1195

Clone Sequence Records

BO28902.complete Sequence

1195 bp assembled on 2011-08-24

GenBank Submission: KX797625

> BO28902.complete
GAAGTTATCAGTCGACATGTGCGACGTGCTCCTCCCATGCGAGTATAATC
CAAAGGAATGTCCGAGTCCTGCGGCGGAGAAGAGCCGCCTCTTCACGATC
CTTTTGCTCTACTGTTGGCAGCGGGAGTACGATAAGAGACCCTACCGCCA
GTTCCAGTTCAAGCGACTCACGTTCGAGGAACGGATTGGTCGGAGGTACC
ACTGCATCCGTGACTTGCGGATCATCGTTAACTATCTGCTGCGGCGTCCC
CAGTTGTCTGTCCAAATTTCCAGCTTGGTTGTCAGCAACTGGGATGCGGG
CTTGCTGAAGGACTTTGTCCGCTCGCTGCTCCCCGTTTGGTACATCGAGC
TGCGACTGATGCGGTTTCCTCGGGAGTTCTTCGTGATGCTGCGTCTCAAT
GCGGCCAAGATGAATGTTAGCCAGCTCAGCTTGGAAGGAACACCCCTCAC
CGATGAAGACGTGCGCATCCTGCGAGAATTCCTGCTGGTAAGCAAGACTC
TGCGCAGGCTCAACGTGTCCAGCTGCAGCCTGACACAGTTCAACTTCGCT
CTGATCGCGGACGGAGTGTATAAGTCGCCTGGAGTGCGACGCTTGAGCGC
CAACCGGCTGCTGGGGATGAGCCTCAGCCTGGACACGGAGAAAATTTCAT
CCGTGCTGAGCTCGCTGCTGATGCAGAATACACTCTGGGCTCTTTCGCTG
GAGCACTGCGAACTGACCGCCCAGGACATGATTCCCATTGCCGAGCACCT
GGCACGGACCAACTCGAAATTTCGGCGCCTGCGAATCGCCTGCAACAAGA
TCGGTCCGGATGGAGCCTTCTTTCTGCTGCGTGGAATGTCCATGGGTGGC
AATCTGGAGTTGCTGGACCTGAGCTACTGCTCGATTGGTACGCACGGCGG
CGAGTGGGTGGCCAAGTACCTGGCCTCGTGCCGCAGACTGCAGGTCCTGC
ACTTGAACTACAACGACATGGGTCCGACGGCAGTGAATCTCATCCTTCTG
GCCATGAAGAAACAGTGCAAGCTGGAAAAACTAACCTTGTATGGCAACCA
CTTTGACTCGCGTACCGCGATGATAGTGCGTCGCTTGCTGGATGCCGAGG
TAGTACTCCACTCCGAGCTGGACATCAGTTACACATACGACGAGGCACTG
CAGGATTACAGAGTGGTGCCTTGGCGTGCAAGCTTTCTAGACCAT

BO28902.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-RB 1164 CG8197-PB 1..1161 17..1177 5805 100 Plus
CG8197-RA 1164 CG8197-PA 1..1161 17..1177 5805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-RB 1390 CG8197-RB 65..1225 17..1177 5805 100 Plus
CG8197-RA 1288 CG8197-RA 65..1225 17..1177 5805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9060626..9061367 1177..436 3710 100 Minus
2R 25286936 2R 9061439..9061860 438..17 2110 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:56:37 has no hits.

BO28902.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:53 Download gff for BO28902.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 65..1225 17..1179 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:44 Download gff for BO28902.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 65..1225 17..1179 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:58:41 Download gff for BO28902.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 65..1225 17..1179 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:58:41 Download gff for BO28902.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9061440..9061860 17..437 100   Minus
2R 9060624..9061365 438..1179 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:44 Download gff for BO28902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4948945..4949365 17..437 100   Minus
arm_2R 4948129..4948870 438..1179 99 <- Minus

BO28902.pep Sequence

Translation from 16 to 1195

> BO28902.pep
MCDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQFKR
LTFEERIGRRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDF
VRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVR
ILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLG
MSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNS
KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAK
YLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRT
AMIVRRLLDAEVVLHSELDISYTYDEALQDYRVVPWRASFLDH

BO28902.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-PB 387 CG8197-PB 1..387 1..387 2002 100 Plus
CG8197-PA 387 CG8197-PA 1..387 1..387 2002 100 Plus