Clone BO28906 Report

Search the DGRC for BO28906

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG32154-RA
Protein status:BO28906.pep: Imported from assembly
Sequenced Size:1069

Clone Sequence Records

BO28906.complete Sequence

1069 bp assembled on 2011-08-24

GenBank Submission: KX798186

> BO28906.complete
GAAGTTATCAGTCGACATGGCGGAAAGCGCTTATACCGATGCGCCGTACC
TCAACCGCGTACCGACAGTTGGTGTGATGTGCATCGATATCGCCACGCAA
CTGCAGCAGAACTTTAGTGGTGCATATCACAGCTATTTGGCTGCATCCTA
TGTCAAATTTTTGGAGGCATCCGGTGCGCATGTGGTTCCCATTTGGATCG
GCCGAGAACGAGCTTACTATGCGTTGATGATGAGCCAGTTAAATGGCATT
CTTCTGCCAGGTGGAGCCGTGTTCATCGACGAGGCTGATAGGCAAGCCAA
TCCGGATGTGACCAGCGATTGCGTCCGGAGTGCCGAGCTCATCTACCAAT
TGGCTATGGAGCGTAATATGCGGGCGAAGAAGTTGGATGATCGTGGCGCA
TACTTTCCCGTTTGGGGAACTTGTCTTGGCTTCCAGTTGATCCTTATTCA
CGCTGCCGAAGCACCGAATGTTCGAATCGCCTGTCAGCCCATGAGGGAGG
CGATGCCAGTTACTCTGACCGATGACTATCAACAATCACAACTGCTTGGA
AGTCTGCCGAAATCGGTTGCCGATGAGATGGAGAAGCACCCATTTGCCTG
CCATCAGCATCGGTATTGCATCACTAAAGAGAGTTTGGAATCCTATGGTC
TAGCTAAGGATTGGCATCCCCTGGCCACTCAGAAGGACACTTCAGGACTG
GAATTCATCACGATTGTCGAGCACAGGCGTTTTCCCATCTTTGGATGTCA
GTTTCATCCTGAGCGCGCTGCATTTGAGCAGCTTTTCAACTCACCGGACA
AATGTTACATGGCGCATTCTCGCATGGGTATCGATTTGTCCCAAATCTTT
GGCAGTCGGTTTGTTGACTTCTGCCGCCGCAACAACAATCAGTTCGAAAG
TGACAAATTAAAAACCAGACATCTCATTTGGAACTGGCAGCCCGTTTTCT
CTGGCAAGTTCAAGGGCTCCAACTGGCAGCAGTGCTATCTATTTGAGAAG
AACGTGGACTATTCGGAAGAGCCGGATGATTCTGAGGAGCTTCGCTCATC
TGCAAGCTTTCTAGACCAT

BO28906.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-RA 1038 CG32154-PA 1..1035 17..1051 5175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-RA 1138 CG32154-RA 36..1070 17..1051 5175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16238538..16239394 195..1051 4285 100 Plus
3L 28110227 3L 16237758..16237937 17..196 900 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:57:03 has no hits.

BO28906.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:53 Download gff for BO28906.complete
Subject Subject Range Query Range Percent Splice Strand
CG32154-RA 1..1035 17..1053 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:59 Download gff for BO28906.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 36..1070 17..1053 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:58:53 Download gff for BO28906.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 36..1070 17..1053 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:58:53 Download gff for BO28906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16238539..16239394 196..1053 99   Plus
3L 16237758..16237936 17..195 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:59 Download gff for BO28906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16231639..16232494 196..1053 99   Plus
arm_3L 16230858..16231036 17..195 100 -> Plus

BO28906.pep Sequence

Translation from 16 to 1069

> BO28906.pep
MAESAYTDAPYLNRVPTVGVMCIDIATQLQQNFSGAYHSYLAASYVKFLE
ASGAHVVPIWIGRERAYYALMMSQLNGILLPGGAVFIDEADRQANPDVTS
DCVRSAELIYQLAMERNMRAKKLDDRGAYFPVWGTCLGFQLILIHAAEAP
NVRIACQPMREAMPVTLTDDYQQSQLLGSLPKSVADEMEKHPFACHQHRY
CITKESLESYGLAKDWHPLATQKDTSGLEFITIVEHRRFPIFGCQFHPER
AAFEQLFNSPDKCYMAHSRMGIDLSQIFGSRFVDFCRRNNNQFESDKLKT
RHLIWNWQPVFSGKFKGSNWQQCYLFEKNVDYSEEPDDSEELRSSASFLD
H

BO28906.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-PA 345 CG32154-PA 1..345 1..345 1851 100 Plus
l(3)72Dp-PA 373 CG32155-PA 26..331 16..341 516 34.7 Plus