Clone BO28908 Report

Search the DGRC for BO28908

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCheB93b-RA
Protein status:BO28908.pep: Imported from assembly
Sequenced Size:643

Clone Sequence Records

BO28908.complete Sequence

643 bp assembled on 2011-08-24

GenBank Submission: KX798364

> BO28908.complete
GAAGTTATCAGTCGACATGGACCGGCAACAAGTTACACTGCTGAATATCC
TTATATCCCTAACATTGCAAATAATAAGCCCTTCATTTGCATTAAATCAC
TTTTTTATTCCTGAAAGGGAAGAGCTGTTTAGTGAGTGCCTCGACAAGCC
AGGATTTTCTTACGTGAATGAGTTGGCTGATCTTTCCCGATTTAACCGTA
AAAAAGATGCAGATGGGGCCATGAATATATCTGGAAACATAACCATGTTA
TGGGACGTCGAACCTTCAAATCGCGTCGCGGTTGAAGTAAACATAGAAAA
ATTTGAAGGAGGTACTTGGAATCCAACATTATTCAAAGGAGGTGATAAGG
ATTTCTGCAAGAACTTCTATGATAAGAACACCATTTATTATCCTTTCTCG
ACAAAACACGTAATCAACAAGCAGCAAGTTAAGGACAAATGCATTACAAC
TCCGGGAACAGTTTTAGTCCTGGAACCATTTATCCTGAAGATATTAATCA
ATTTCGCAGTGCCTCTAAGCCCAGGAATTCACAAGGCTGTCATTATATTT
TCTGCATTCGACAAATCTGGTGTTAAGCGTCCACGGGACACTTGCATTGA
AATTGTTGGCGAAATAGTGAATATCGCAAGCTTTCTAGACCAT

BO28908.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
CheB93b-RA 612 CG31438-PA 1..609 17..625 3045 100 Plus
CheB93a-RA 603 CG15503-PA 199..597 224..622 345 72.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
CheB93b-RA 680 CG31438-RA 3..613 15..625 3055 100 Plus
CheB93a-RA 751 CG15503-RA 206..604 224..622 345 72.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21409125..21409392 15..282 1340 100 Plus
3R 32079331 3R 21409452..21409629 280..457 890 100 Plus
3R 32079331 3R 21409690..21409857 458..625 840 100 Plus
3R 32079331 3R 21407787..21407942 302..457 240 76.9 Plus
Blast to na_te.dros performed 2014-11-27 06:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 5962..5993 92..61 106 81.2 Minus

BO28908.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:55 Download gff for BO28908.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..609 17..627 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:00:41 Download gff for BO28908.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 5..613 17..627 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:21 Download gff for BO28908.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 5..613 17..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:21 Download gff for BO28908.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21409690..21409857 458..627 98   Plus
3R 21409453..21409629 281..457 100 -> Plus
3R 21409127..21409390 17..280 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:00:41 Download gff for BO28908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17235412..17235579 458..627 98   Plus
arm_3R 17235175..17235351 281..457 100 -> Plus
arm_3R 17234849..17235112 17..280 100 -> Plus

BO28908.pep Sequence

Translation from 16 to 643

> BO28908.pep
MDRQQVTLLNILISLTLQIISPSFALNHFFIPEREELFSECLDKPGFSYV
NELADLSRFNRKKDADGAMNISGNITMLWDVEPSNRVAVEVNIEKFEGGT
WNPTLFKGGDKDFCKNFYDKNTIYYPFSTKHVINKQQVKDKCITTPGTVL
VLEPFILKILINFAVPLSPGIHKAVIIFSAFDKSGVKRPRDTCIEIVGEI
VNIASFLDH

BO28908.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
CheB93b-PA 203 CG31438-PA 1..203 1..203 1061 100 Plus
CheB93a-PA 200 CG15503-PA 16..199 18..202 604 58.4 Plus
CheB42b-PA 196 CG33351-PA 2..191 11..199 345 36.6 Plus
CheB98a-PB 197 CG14531-PB 29..195 35..203 344 40 Plus
CheB38a-PA 197 CG33320-PA 11..196 19..203 338 36.9 Plus