Clone BO28909 Report

Search the DGRC for BO28909

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG30401-RA
Protein status:BO28909.pep: Imported from assembly
Sequenced Size:859

Clone Sequence Records

BO28909.complete Sequence

859 bp assembled on 2011-08-25

GenBank Submission: KX798040

> BO28909.complete
GAAGTTATCAGTCGACATGGAAAGATTTGGTATTCCACGTGGTAAGCGTC
CCCGAGTCCAAGTTTCATTGGACGACAAGGAGCGAGCCATAGCCCGAATC
CGAGGTGGTGAAACCAAGGCCGGAATATCACGCGAATTGGGTGTTCCGGA
GTCTACGGTTCGCGGTTGGGTGAAACGAGCTGAGCAGCGGTTGGCCCGAG
AGACAACTAGCCAAACGGGTTCTGCCAACTATTCCACAATCCTGGCCATG
ACCCTAGCGAAACCGCAAGTTACCATCAGCACAAAATCGTCGGCTTCGTC
TGTCATTTCTAAATCATCATACTCATCGCCACCGCTGGATTTGAAACCCC
TGAAACAGCCCCAGAAACGAAACATTAATGGTCATCCGGTAACGTGCACC
CAGGATCCAGTCGAGGATTCAGCAGCTACATCCATCCCCATCCCCGTTCC
GATTCCGGTGCCCCTTCCTGTGCCGCCAATGGTTTCGCCTGACAGTGAGC
AACAGATGAGCGCTTGGTTGCATATATTCAATGCGGGAATTCTGAACTTC
ACTCTGATTGCCTCCGCTGCAGTGCTTCAGGCTCGCTCGCGTGGTTTGGC
GGATCGCCTGCCGTTGTGGCAAATTATCACGGATTTTGTTGATGAAGCCG
AACGTAATGTGAATGCCAACGGGGGTTGGTACCTCGAGGGACAGCCGGCG
ACAGGACACATGAGTGCCAGGCAACGGCCAGTCCGAGTGCCCACGAAGGT
GCATTCATATCGCAGGAACTTGAAGGCACCACCGGCTCATATTACCGCCG
AAGATGACGAAGACTCCTACACGGACGCTGATGTGCCACACGCAAGCTTT
CTAGACCAT

BO28909.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-RC 828 CG30401-PC 1..825 17..841 4125 100 Plus
CG30401-RA 828 CG30401-PA 1..825 17..841 4125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-RC 1188 CG30401-RC 225..1049 17..841 4125 100 Plus
CG30401-RA 1258 CG30401-RA 295..1119 17..841 4125 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21985765..21986395 841..211 3140 99.8 Minus
2R 25286936 2R 21986441..21986644 220..17 1020 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:54:10 has no hits.

BO28909.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:27:36 Download gff for BO28909.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..825 17..843 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:18 Download gff for BO28909.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 173..997 17..843 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:26 Download gff for BO28909.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 295..1119 17..843 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:26 Download gff for BO28909.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21986443..21986644 17..218 100   Minus
2R 21985762..21986387 219..843 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:18 Download gff for BO28909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17873948..17874149 17..218 100   Minus
arm_2R 17873267..17873892 219..843 99 <- Minus

BO28909.pep Sequence

Translation from 16 to 859

> BO28909.pep
MERFGIPRGKRPRVQVSLDDKERAIARIRGGETKAGISRELGVPESTVRG
WVKRAEQRLARETTSQTGSANYSTILAMTLAKPQVTISTKSSASSVISKS
SYSSPPLDLKPLKQPQKRNINGHPVTCTQDPVEDSAATSIPIPVPIPVPL
PVPPMVSPDSEQQMSAWLHIFNAGILNFTLIASAAVLQARSRGLADRLPL
WQIITDFVDEAERNVNANGGWYLEGQPATGHMSARQRPVRVPTKVHSYRR
NLKAPPAHITAEDDEDSYTDADVPHASFLDH

BO28909.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-PC 275 CG30401-PC 1..275 1..275 1418 100 Plus
CG30401-PA 275 CG30401-PA 1..275 1..275 1418 100 Plus
danr-PA 419 CG13651-PA 16..66 8..59 156 61.5 Plus