Clone BO28910 Report

Search the DGRC for BO28910

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG14811-RA
Protein status:BO28910.pep: Imported from assembly
Sequenced Size:745

Clone Sequence Records

BO28910.complete Sequence

745 bp assembled on 2011-09-14

GenBank Submission: KX799982

> BO28910.complete
GAAGTTATCAGTCGACATGAAGCCAATAATGGAAACGAATATACAGGCAT
CCATTTGGAACAAGAGATTCGAATCGACGATGATGAGTTCTTCCGAGCAA
AGTTTTGCCAAGTCCAATGGGACTAAAAAGAAGACTGTGACCTATTCACG
TTTCATCCGCACCGAACGTGTCGCAGACGGACCGACCAATGCGGTGCAAA
AGAAGACTGTGTTCTTTTCGCGATTCGACCGCACCGCTCGCGCCGAAGAG
GACCTAACCCGTCAATTGGCCAGCGTGTCCTTAAAACCAAAACAGCCTGT
GGCTTCCACCTCGAATGAGCAGTTTTTTGCCAGCAACCTGCATTACTATC
CCCATCTGCCCCAGCCAACTGCGGTGGGCCACTACCAGACCTATGCCGAA
ATCAAGAGCCTCTGGTTGAAGGGTCATTTCTCCCAAGCTTGTAACCCCAC
CTCGCGGTCGATGCAACCGCCTCGTCGTATTTCTATCACCAACGAGTTCC
CGGATGATCAACCGAAGCCAGCTCCCAAACGCCGCTACTCGCTTGTCCGC
CGCAACTCGATTAACCTCCCAATTGGGTCCAATTTTGCTATGCCCGTGCT
GATGGAGGAGGAGAAGGAGGAGGATGAAGTGAAGGATCTAAATGAGAACA
GCGGCTCCACCAAGCCAGCTACATCGACCTCGAAAGGCGCAATCCCGAAG
CAGCCCAAGAAGTTCGCCTTAACCTTCGCAAGCTTTCTAGACCAT

BO28910.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-RB 714 CG14811-PB 1..711 17..727 3555 100 Plus
CG14810-RB 606 CG14810-PB 1..258 29..286 690 84.5 Plus
CG14810-RA 609 CG14810-PA 1..261 29..286 625 83.5 Plus
CG14810-RB 606 CG14810-PB 269..431 462..624 530 88.3 Plus
CG14810-RB 606 CG14810-PB 491..603 615..727 355 87.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-RB 849 CG14811-RB 105..815 17..727 3555 100 Plus
CG14810-RB 717 CG14810-RB 55..321 20..286 705 84.3 Plus
CG14810-RA 720 CG14810-RA 55..324 20..286 640 83.3 Plus
CG14810-RB 717 CG14810-RB 332..494 462..624 530 88.3 Plus
CG14810-RB 717 CG14810-RB 554..666 615..727 355 87.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1821503..1822172 727..58 3350 100 Minus
X 23542271 X 1819891..1820119 286..58 605 84.3 Minus
X 23542271 X 1819718..1819880 624..462 530 88.3 Minus
X 23542271 X 1819546..1819658 727..615 355 87.6 Minus
X 23542271 X 1822236..1822277 58..17 210 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:21:39 has no hits.

BO28910.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:46 Download gff for BO28910.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RA 1..648 80..729 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:04 Download gff for BO28910.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 105..815 17..729 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:02 Download gff for BO28910.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 105..815 17..729 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:02 Download gff for BO28910.complete
Subject Subject Range Query Range Percent Splice Strand
X 1822236..1822277 17..58 100   Minus
X 1821501..1822171 59..729 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:04 Download gff for BO28910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1716269..1716310 17..58 100   Minus
arm_X 1715534..1716204 59..729 99 <- Minus

BO28910.pep Sequence

Translation from 16 to 745

> BO28910.pep
MKPIMETNIQASIWNKRFESTMMSSSEQSFAKSNGTKKKTVTYSRFIRTE
RVADGPTNAVQKKTVFFSRFDRTARAEEDLTRQLASVSLKPKQPVASTSN
EQFFASNLHYYPHLPQPTAVGHYQTYAEIKSLWLKGHFSQACNPTSRSMQ
PPRRISITNEFPDDQPKPAPKRRYSLVRRNSINLPIGSNFAMPVLMEEEK
EEDEVKDLNENSGSTKPATSTSKGAIPKQPKKFALTFASFLDH

BO28910.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-PB 237 CG14811-PB 1..237 1..237 1228 100 Plus
CG14810-PB 201 CG14810-PB 1..201 5..237 499 48.4 Plus
CG14810-PA 202 CG14810-PA 1..202 5..237 487 48.2 Plus