Clone BO28912 Report

Search the DGRC for BO28912

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG42300-RA
Protein status:BO28912.pep: Imported from assembly
Sequenced Size:577

Clone Sequence Records

BO28912.complete Sequence

577 bp assembled on 2011-08-24

GenBank Submission: KX797118

> BO28912.complete
GAAGTTATCAGTCGACATGATCAAAATGGACCCGAAATCCCACCAAAAGC
TCTTCAAGGAAATGGCAGAAGTCGTGTCCAATTCCAGCGATGACGGGGAG
AAGTTGCTAACCAAAAACTCTAGCAACACCATCGAGAAGTCCGAGGAAGT
CTGCAAGGAGCGCCCCGAAGCTGTGGAGCAGATGCGCATCGATGTCAATA
ACTCACTTGAGGACACGAACATGAATGCGGTGGAATCAGAAGCTCAAAAG
AATATCGCCGGCCTTGATGAGGACCTTATCATGGAAGACTTCGGCGTCGA
GGTCGTCCCGTTCCACGATCCCTGGTCCAAGCTATTGATAAAGCACCCCG
TGCGCAACAAAAGGTGCGGCCATATCTACGACCGCGAAACGGTTTTAATG
ATCATCAAGGACAACATTGGCATCCTATGCCCGGTGCGCGACTGTCCCAA
CTTGTCCGACATCAAGTTAGAGCACCTGGTCAAGGACCCCGACGTGGAGC
AGGAGTTGCAAAAGCGCAAGTCCGACAAGATCCAGAATGAAACTTCCTCG
GATGAGGACGCAAGCTTTCTAGACCAT

BO28912.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-RA 546 CG42300-PA 1..543 17..559 2715 100 Plus
CG42299-RA 549 CG42299-PA 1..546 17..559 2575 98.5 Plus
cerv-RD 693 CG15645-PD 363..673 250..560 745 82.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-RA 726 CG42300-RA 71..613 17..559 2715 100 Plus
CG42299-RA 679 CG42299-RA 21..566 17..559 2575 98.5 Plus
cerv-RD 1141 CG15645-RD 645..955 250..560 745 82.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15555366..15555855 559..70 2450 100 Minus
X 23542271 X 15575060..15575552 559..70 2325 98.6 Minus
X 23542271 X 15577172..15577482 560..250 745 82.6 Minus
3L 28110227 3L 17479760..17480055 265..560 565 79.4 Plus
X 23542271 X 15577548..15577642 205..111 385 93.7 Minus
X 23542271 X 15555921..15555975 71..17 275 100 Minus
3L 28110227 3L 17479577..17479663 112..198 270 87.4 Plus
X 23542271 X 15575609..15575663 71..17 260 98.2 Minus
Blast to na_te.dros performed on 2014-11-27 06:56:10 has no hits.

BO28912.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:52 Download gff for BO28912.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 37..579 17..561 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:30 Download gff for BO28912.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 71..613 17..561 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:58:30 Download gff for BO28912.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 71..613 17..561 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:58:30 Download gff for BO28912.complete
Subject Subject Range Query Range Percent Splice Strand
X 15555921..15555975 17..71 100   Minus
X 15555364..15555853 72..561 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:30 Download gff for BO28912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15449954..15450008 17..71 100   Minus
arm_X 15449397..15449886 72..561 99 <- Minus

BO28912.pep Sequence

Translation from 16 to 577

> BO28912.pep
MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERP
EAVEQMRIDVNNSLEDTNMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFH
DPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIK
LEHLVKDPDVEQELQKRKSDKIQNETSSDEDASFLDH

BO28912.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-PA 181 CG42300-PA 1..181 1..181 938 100 Plus
CG42299-PA 182 CG32584-PA 1..182 1..181 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..230 9..187 493 53.7 Plus
cerv-PA 230 CG15645-PA 17..230 9..187 493 53.7 Plus
cerv-PC 177 CG15645-PC 16..177 33..187 466 60.5 Plus