Clone BO28914 Report

Search the DGRC for BO28914

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptScgdelta-RB
Protein status:BO28914.pep: Imported from assembly
Sequenced Size:1228

Clone Sequence Records

BO28914.complete Sequence

1228 bp assembled on 2011-08-24

GenBank Submission: KX799705

> BO28914.complete
GAAGTTATCAGTCGACATGTTGGCCGCTGGCAGCAGTGAGATCACTGACT
TTGGGCCACACTCGCGCCAACTAACGGCTGGCAACACGCCCAAGCGACCC
AACAAGGCCAGCAGCCACCGTCCTGGTTCTGGTTCTGGTCCTGGCCCAAT
GACAACTGGTGGCACCAGCTCAGCGAGCGGTAACGGAAACAGCGGTGGGG
CTCTGAACGCCATTCCCACGACGAAGGTCGGGAGCGGAGGAGGCGGCGGA
GGCGCCATGTCCGCCACAACGGTGACTGCGACGACGGGGAAAGCTACTGT
AAGCCATGGCCATAGTCATGGCCACGCTCTGGGGCGCAGCGAGACGAGGA
GCGGTCGGAGCGCAGCAGCTGGACGCTCCAATGTGGACGGATTCGTTGGC
GGAATCGAGACGTACTTGGGCCTCATCGGGTGGCGAAAAAAGTGCCTGTA
TACCCTGCTGCTACTGCTGATGCTGCTCATCATCACGAACCTGGTGCTCA
CCCTCTGGATACTCAAGGAGGGCATGGGGCAGCTTAAAATCGTACCCGGT
GGCATACAGCTGTCCGGACAAGCGATAATTATGGACATGCTGCGCGCCTC
CACAATCCGTTCGCGGCACGGTCAACCCATTTCCATAGAGTCATCACGTA
ACTTTTCAATCAATACACGTGATCCGAATGGCATGATTGAGAATCATTTA
TTCCTGGGACACGATAAGTTCGAGTGCCTGTCGGCGGGATTTCGCATAAA
CGACACCAACGGACGCAGCCTGTTCTCCGTGAACCGAGATGAAGTCACCA
TCGGAGCACATGCCCTGCGGATCGACGGCGAAGGTGGCGCCGTCTTCCGG
GAATCCGTGCAGACGCCCCATGTGCGGGCCGAGCCCGGCCGGGAGCTGAG
ACTCGAATCGCCCACACGCCAATTGGAGATGACGGCGGCCAAGGACATCA
ATTTGCAATCGCGGGCAGGAGGCATAGAAGTCGTGGCCCTGGAAGACGTC
AAGTTCCGAGCCCTCGATGGGAGCCTGCGCCTGGAGTCCTCCAAGATACT
TATGCCCAACCTGCGGACGGCCCAGCCGCCCATTCTGGGCACTGCCCAAA
GCAGGGATCACATGCACCGCGTCTTCCAACTCTGCGCCTGTTCCAATGGC
AAGCTTTTCCTCGCTGCACCCCACTCCATATGTGCCGGCGATGATTCCAC
GGTCTGCAGAGCAAGCTTTCTAGACCAT

BO28914.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-RE 1215 CG14808-PE 1..1212 17..1210 5755 98.5 Plus
Scgdelta-RD 1215 CG14808-PD 1..1212 17..1210 5755 98.5 Plus
Scgdelta-RC 1215 CG14808-PC 1..1212 17..1210 5755 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-RE 2972 CG14808-RE 422..1633 17..1210 5755 98.5 Plus
Scgdelta-RD 2336 CG14808-RD 609..1820 17..1210 5755 98.5 Plus
Scgdelta-RC 2966 CG14808-RC 416..1627 17..1210 5755 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1749912..1750413 518..17 2510 100 Minus
X 23542271 X 1748032..1748302 900..630 1325 99.3 Minus
X 23542271 X 1746394..1746579 1210..1025 930 100 Minus
X 23542271 X 1746687..1746812 1024..899 630 100 Minus
X 23542271 X 1749697..1749819 638..516 615 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:08:14 has no hits.

BO28914.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:57 Download gff for BO28914.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RD 1110..1820 508..1212 98   Plus
Scgdelta-RD 614..1099 22..507 100 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:08 Download gff for BO28914.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RA 923..1633 508..1212 98   Plus
Scgdelta-RA 427..912 22..507 100 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:02 Download gff for BO28914.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RC 917..1627 508..1212 98   Plus
Scgdelta-RC 421..906 22..507 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:12:02 Download gff for BO28914.complete
Subject Subject Range Query Range Percent Splice Strand
X 1749913..1750408 22..517 100   Minus
X 1749697..1749817 518..638 100 <- Minus
X 1748032..1748293 639..900 100 <- Minus
X 1746687..1746810 901..1024 100 <- Minus
X 1746391..1746579 1025..1212 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:08 Download gff for BO28914.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1643946..1644441 22..517 100   Minus
arm_X 1643730..1643850 518..638 100 <- Minus
arm_X 1642065..1642326 639..900 100 <- Minus
arm_X 1640720..1640843 901..1024 100 <- Minus
arm_X 1640424..1640612 1025..1212 98 <- Minus

BO28914.pep Sequence

Translation from 16 to 1228

> BO28914.pep
MLAAGSSEITDFGPHSRQLTAGNTPKRPNKASSHRPGSGSGPGPMTTGGT
SSASGNGNSGGALNAIPTTKVGSGGGGGGAMSATTVTATTGKATVSHGHS
HGHALGRSETRSGRSAAAGRSNVDGFVGGIETYLGLIGWRKKCLYTLLLL
LMLLIITNLVLTLWILKEGMGQLKIVPGGIQLSGQAIIMDMLRASTIRSR
HGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGR
SLFSVNRDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPT
RQLEMTAAKDINLQSRAGGIEVVALEDVKFRALDGSLRLESSKILMPNLR
TAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHSICAGDDSTVCRAS
FLDH

BO28914.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-PE 404 CG14808-PE 1..404 1..398 2030 98.5 Plus
Scgdelta-PD 404 CG14808-PD 1..404 1..398 2030 98.5 Plus
Scgdelta-PC 404 CG14808-PC 1..404 1..398 2030 98.5 Plus
Scgdelta-PA 404 CG14808-PA 1..404 1..398 2030 98.5 Plus