Clone BO28918 Report

Search the DGRC for BO28918

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptCG42853-RA
Protein status:BO28918.pep: Imported from assembly
Sequenced Size:886

Clone Sequence Records

BO28918.complete Sequence

886 bp assembled on 2011-08-24

GenBank Submission: KX793747

> BO28918.complete
GAAGTTATCAGTCGACATGGCCACAAGCGCGAACTCTGTTCAAGTTTCTG
GAGCCGGTGCGGAGGTAAACGAAGCTAAACTCATCTGCATCTGGGAGGGA
ATAACTGAGCTGATCCTGTGGCGCAACTGGATAAAGTCGATGCTTGTATT
CGTAATGCTACAGACCATAATTTATGATCTGCTTTCTGAACCGCTTGTGT
TCGTGGTGAGCGTATGGGCTTTGATTATCATGGTCATATCAATGGGGTAC
CGTTTTTTGGTACAGTACACTAATACCCATATCCAGAACAACAGCTATCC
GAAATATCTTGACATAGACCTAAGAATCTCCCAGGAGTTATCTAAGCAAC
TGGGTGTTCTAGTTTCAACCAAAGTTGTTGCGTTTCTAAATAATCTACGA
GAGATATTACTAGTAAAGAGCTTTTCGAAATCATTCAAGTGGTTTGGCCT
TCTCCTAATAATTAGCAAACTTGGAAAGCAGATTAACTTTCTAATTGTTG
GCCAATTAGGGCTGTTTCTACTCTTCACAATTCCCAAAATGTGTGAGATG
AATAGACGTTCATCAAATATTGTACAACTTCCTAAATTTAATAAACAATA
TCAAATTACCAAAGTAAACGCTTCGACCGAAACCCAGAATGCATTGGACA
TGGAATCCTTAAAAGAGTGCAACGAGGACACCATAAAGCTAATTGAAAAG
CAACCAGAAGGGATGGATCTCTCACTCGGCTGTGATATTACCAAGGAATC
CCAGAATGCGGCTGATGATCTTAAAGCCTTTAAAGTAAAGGAGGAAATAG
ACATTGATGCTTTTGAGCGACTTGCCGATTCCTGGTCCGACGAAGATACA
CTTACTGATCAAAAAAATGCAAGCTTTCTAGACCAT

BO28918.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-RA 855 CG42853-PA 1..852 17..868 4260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-RA 1001 CG42853-RA 63..914 17..868 4260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18121434..18121927 510..17 2470 100 Minus
3L 28110227 3L 18121019..18121379 868..508 1805 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:08:39 has no hits.

BO28918.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:58 Download gff for BO28918.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 63..906 17..860 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:20 Download gff for BO28918.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 63..906 17..860 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:12 Download gff for BO28918.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 63..906 17..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:12:12 Download gff for BO28918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18121435..18121927 17..509 100   Minus
3L 18121027..18121377 510..860 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:20 Download gff for BO28918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18114535..18115027 17..509 100   Minus
arm_3L 18114127..18114477 510..860 100 <- Minus

BO28918.pep Sequence

Translation from 16 to 886

> BO28918.pep
MATSANSVQVSGAGAEVNEAKLICIWEGITELILWRNWIKSMLVFVMLQT
IIYDLLSEPLVFVVSVWALIIMVISMGYRFLVQYTNTHIQNNSYPKYLDI
DLRISQELSKQLGVLVSTKVVAFLNNLREILLVKSFSKSFKWFGLLLIIS
KLGKQINFLIVGQLGLFLLFTIPKMCEMNRRSSNIVQLPKFNKQYQITKV
NASTETQNALDMESLKECNEDTIKLIEKQPEGMDLSLGCDITKESQNAAD
DLKAFKVKEEIDIDAFERLADSWSDEDTLTDQKNASFLDH

BO28918.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-PA 284 CG42853-PA 1..284 1..284 1433 100 Plus
Rtnl2-PC 255 CG1279-PC 15..226 25..240 182 25.9 Plus
Rtnl2-PB 255 CG1279-PB 15..226 25..240 182 25.9 Plus
Rtnl1-PL 222 CG33113-PL 7..182 11..182 150 25 Plus