Clone BO28926 Report

Search the DGRC for BO28926

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:26
Vector:pDNR-Dual
Associated Gene/Transcript4EHP-RC
Protein status:BO28926.pep: Imported from assembly
Sequenced Size:592

Clone Sequence Records

BO28926.complete Sequence

592 bp assembled on 2011-08-24

GenBank Submission: KX798766

> BO28926.complete
GAAGTTATCAGTCGACATGAGCATGGAGAAAGTAGCCAACAAGCAGTACG
AGACGAAAAACTGGCCAGATATTGTCGACAGCGACGACAGCGATGTGGAT
AATCAGATAGATGTGGACAACCTGCCACCACTGGAGGTGGGTCCCGGCGA
GAACCGGCTGCAGCACACATACTGCCTCTGGTTCTCTCGCAAGGAGACGC
AGCGCGCGGCCGCCGACTACAGCAAGTCGCTGCACATGGTCGGCCGGTGC
GCCAGCGTGCAGCAGTGGTGGTCGCTCTACTCGCACCTCATCCGGCCCAC
CGCCCTGAAGCCCTACCGGGAGCTCCTCCTCTTCAAGCAGGGCATCATAC
CGATGTGGGAGGACCCGGCGAACAGCAAGGGCGGCCAGTGGTTGATACGA
CTACGCAAGAACAAGGTCGACCGGGCCTGGGAGAACGTTTGTATGGCGAT
GCTCGGGGAGCAGTTCCTCGTCGGCGACGAGATATGCGGAGTCGTGCTAC
AGACGAAATATCCGATAAAAACCGAACACAGCCGGCCAATGCATACAAAT
GAGCGAAGGAGCGATGGAGTCACGGCAAGCTTTCTAGACCAT

BO28926.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RC 561 CG33100-PC 1..558 17..574 2790 100 Plus
4EHP-RB 747 CG33100-PB 1..499 17..515 2495 100 Plus
4EHP-RD 729 CG33100-PD 1..498 17..514 2490 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RC 4539 CG33100-RC 454..1011 17..574 2790 100 Plus
4EHP-RB 2401 CG33100-RB 454..952 17..515 2495 100 Plus
4EHP-RD 1324 CG33100-RD 454..951 17..514 2490 100 Plus
4EHP-RB 2401 CG33100-RB 1702..1762 514..574 305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24106825..24107284 514..55 2300 100 Minus
3R 32079331 3R 24068005..24068065 574..514 305 100 Minus
3R 32079331 3R 24108469..24108507 55..17 195 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:12:15 has no hits.

BO28926.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:01 Download gff for BO28926.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 414..971 17..576 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:51 Download gff for BO28926.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 454..1011 17..576 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:31 Download gff for BO28926.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 454..1011 17..576 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:13:31 Download gff for BO28926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24108470..24108507 17..54 100   Minus
3R 24106825..24107284 55..514 100 <- Minus
3R 24068001..24068064 515..576 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:51 Download gff for BO28926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19934192..19934229 17..54 100   Minus
arm_3R 19932547..19933006 55..514 100 <- Minus
arm_3R 19893723..19893786 515..576 96 <- Minus

BO28926.pep Sequence

Translation from 16 to 592

> BO28926.pep
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVTASFLDH

BO28926.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-PC 186 CG33100-PC 1..186 1..186 1012 100 Plus
4EHP-PA 223 CG33100-PA 1..166 1..166 905 100 Plus
4EHP-PD 242 CG33100-PD 1..166 1..166 905 100 Plus
4EHP-PB 248 CG33100-PB 1..166 1..166 905 100 Plus
eIF4E-5-PA 232 CG8277-PA 57..173 48..164 216 35.8 Plus