Clone BO28928 Report

Search the DGRC for BO28928

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG8331-RC
Protein status:BO28928.pep: Imported from assembly
Sequenced Size:493

Clone Sequence Records

BO28928.complete Sequence

493 bp assembled on 2011-08-24

GenBank Submission: KX800061

> BO28928.complete
GAAGTTATCAGTCGACATGGCAGTCGAGGAATTAGAGAGCAAAATTGTCC
AACTGTTCGTAGAGAACCCCCTCCTGCGCTACGGTGCTGTTGGTCTGTGC
GCCATCTACCTGATCTTTGGCTGGGGCGCCCAACTACTGTGCAACATCAT
TGGGGTTCTGTACCCTGCATATATTTCCATCCATGCCATCGAGTCCAGCA
CAAAGCAGGACGACACCAAGTGGCTGATCTACTGGGTCACGTTTGGAATC
TTCACCGTGATTGAATTCTTTTCGAGTCTGCTAACTTCGGTGATTCCCTT
TTACTGGCTGCTGAAGTGTGCTTTCCTCATCTGGTGCATGCTGCCCACGG
AACAGAATGGTTCTACCATCATCTACAACAAGCTGGTGCGACCCTACTTC
CTGAAACATCACGAATCCGTTGACAGGATCATCGATGATGGCATGAAGAA
AGCCGCTGGAGTGCTGAAGCATGACGCAAGCTTTCTAGACCAT

BO28928.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-RC 462 CG8331-PC 1..459 17..475 2295 100 Plus
CG8331-RD 537 CG8331-PD 142..534 83..475 1965 100 Plus
CG8331-RB 483 CG8331-PB 88..480 83..475 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-RC 1023 CG8331-RC 370..830 15..475 2305 100 Plus
CG8331-RD 846 CG8331-RD 261..653 83..475 1965 100 Plus
CG8331-RB 877 CG8331-RB 292..684 83..475 1965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14172289..14172522 83..316 1170 100 Plus
3R 32079331 3R 25786726..25787057 429..98 1090 88.6 Minus
2R 25286936 2R 14172582..14172683 315..416 510 100 Plus
2R 25286936 2R 14172158..14172228 15..85 355 100 Plus
2R 25286936 2R 14172747..14172805 417..475 295 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:13:15 has no hits.

BO28928.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:03 Download gff for BO28928.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 8..466 17..477 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:55:17 Download gff for BO28928.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 372..830 17..477 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:55 Download gff for BO28928.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 372..830 17..477 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:13:55 Download gff for BO28928.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172747..14172805 417..477 96   Plus
2R 14172584..14172683 317..416 100 -> Plus
2R 14172290..14172522 84..316 100 -> Plus
2R 14172160..14172226 17..83 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:55:17 Download gff for BO28928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10060252..10060310 417..477 96   Plus
arm_2R 10060089..10060188 317..416 100 -> Plus
arm_2R 10059795..10060027 84..316 100 -> Plus
arm_2R 10059665..10059731 17..83 100 -> Plus

BO28928.pep Sequence

Translation from 16 to 493

> BO28928.pep
MAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVLYP
AYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLK
CAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAGVL
KHDASFLDH

BO28928.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-PC 153 CG8331-PC 1..153 1..153 812 100 Plus
CG8331-PB 160 CG8331-PB 27..160 20..153 707 98.5 Plus
CG8331-PD 178 CG8331-PD 48..178 23..153 706 100 Plus
CG8331-PA 178 CG8331-PA 48..178 23..153 706 100 Plus
CG4960-PB 174 CG4960-PB 33..174 2..153 536 69.1 Plus