Clone BO28931 Report

Search the DGRC for BO28931

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG42463-RB
Protein status:BO28931.pep: Imported from assembly
Sequenced Size:367

Clone Sequence Records

BO28931.complete Sequence

367 bp assembled on 2011-08-24

GenBank Submission: KX798803

> BO28931.complete
GAAGTTATCAGTCGACATGAAATTACTCTCTGCGGTTCTTCTAATAGGTA
CCTTAAGTGCCATTTGTCTTGGCCAAAAGGAACCCATATGCAGGTCTGAT
CCGAGTGTTGTCGGAAATTGTGGGCATAAAATTAAAGGGTATACCTATGA
AGTTCGAAAAAATAATTGCAAGAAGTTCCGGGCGATGGCCTGTAAGGTAA
CTGGAAACTTTTTCCGTAGCAGGGATGCGTGCAATGCGAAGTGCAAGGAC
ACCAGGAAGCCAGCTCAAAGCGGAGTCATTGAATTCTTCAGTCGAACGGT
GTCGCAGTTTCTGCAGATGATCTTAAGCCTAATGAGTTGGGCCGGATTTG
CAAGCTTTCTAGACCAT

BO28931.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42463-RB 336 CG42463-PB 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42463-RB 384 CG42463-RB 15..347 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3668728..3668993 349..84 1330 100 Minus
2L 23513712 2L 3669054..3669120 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:15:22 has no hits.

BO28931.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:05 Download gff for BO28931.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 15..347 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:09 Download gff for BO28931.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 15..347 17..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:14:46 Download gff for BO28931.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 15..347 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:14:46 Download gff for BO28931.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669054..3669120 17..83 100   Minus
2L 3668725..3668993 84..351 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:09 Download gff for BO28931.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3669054..3669120 17..83 100   Minus
arm_2L 3668725..3668993 84..351 99 <- Minus

BO28931.pep Sequence

Translation from 16 to 367

> BO28931.pep
MKLLSAVLLIGTLSAICLGQKEPICRSDPSVVGNCGHKIKGYTYEVRKNN
CKKFRAMACKVTGNFFRSRDACNAKCKDTRKPAQSGVIEFFSRTVSQFLQ
MILSLMSWAGFASFLDH

BO28931.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42463-PB 111 CG42463-PB 1..111 1..111 585 100 Plus
Sfp24Bc-PA 100 CG42602-PA 5..78 7..78 180 43.2 Plus
Sfp24Ba-PA 121 CG42461-PA 6..75 8..77 174 45.7 Plus
Sfp24Bb-PA 110 CG42462-PA 7..97 13..97 148 35.2 Plus
CG16712-PB 82 CG16712-PB 1..82 1..78 133 35.4 Plus