Clone BO28932 Report

Search the DGRC for BO28932

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG43077-RA
Protein status:BO28932.pep: Imported from assembly
Sequenced Size:898

Clone Sequence Records

BO28932.complete Sequence

898 bp assembled on 2011-08-24

GenBank Submission: KX795139

> BO28932.complete
GAAGTTATCAGTCGACATGAATAAAATGGAAGAAAACTTCTACAATGGAT
GCACTTGTTGCCATTGCTCTTGCCGCCGCTCTTGCTCTTGCTCGTCTTTA
AAACGATGCAATTCCGCTGAATCGTGTCGCTTACTTATTCAGAAAAGTTC
GAAATATATATACGATGGCGTTAGATGCTCAGATCTCAGATGTCCATACT
GCAACGAAGCGCTTGGACAGAAAATCCTTTTATCGCACTCGGCGGAGTCC
ACTGCTCGAACGCCACAACAAACGCGGATTTCCGACATACAGTTTAGTCA
TTCGGATAAAGGACGAAAAAGTTACAGTAAAATGAAATCGATGTCCGGAT
TTGAAGAGCCTAAAGATCAAGTTCAATATAAGAAGAGAGAGTCTAGCATA
TCAACACCATTCAGTTGCTATAGGGAGGATTCGCCAAGGTCCTCGTCCAG
AGTTAAGTCTACCGGAAAGTACAGTTGCAACTGCTTCACAAAGGAACAGC
CAAGAAAGTATGTTTCAAAGACTGCCGAAGAAATCAGAAGGACGGTTCGA
GCGGAGATTGCAGAGATGGAGCAAAAGCAGGCAATGGCAGACAAAAATGG
ATGTGATTTTACTTTTTGCAAGCCACCGCAGAGTGGACGATTGTCATCTA
ATGAAGAAACCAAGAGTAAATCTAAAGATGAAGAGATTTTTACGGAGTCC
GAGAAATTGATACTTAGCAAAATTGATTGGCGTACTACTGCCACCAATGA
TTTGTCTAATTCCGAGGTAATTTATTCGACGATAAAGCGCTTGCTGCGCG
TATGTCTGAACAACAAGATAATCGAACTTGGGCTCCTGGATAGTCTGCAT
GATGCGATAGCACAATTCAAACGAGACAACGCAAGCTTTCTAGACCAT

BO28932.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-RA 867 CG43077-PA 1..864 17..880 4320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-RA 1000 CG43077-RA 67..930 17..880 4320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17067374..17067977 880..277 3020 100 Minus
X 23542271 X 17068131..17068304 277..104 870 100 Minus
X 23542271 X 17068371..17068457 103..17 435 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:15:52 has no hits.

BO28932.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:06 Download gff for BO28932.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 67..930 17..882 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:21 Download gff for BO28932.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 67..930 17..882 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:15:00 Download gff for BO28932.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 67..930 17..882 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:15:00 Download gff for BO28932.complete
Subject Subject Range Query Range Percent Splice Strand
X 17068371..17068457 17..103 100   Minus
X 17068131..17068304 104..277 100 <- Minus
X 17067372..17067976 278..882 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:21 Download gff for BO28932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16962404..16962490 17..103 100   Minus
arm_X 16962164..16962337 104..277 100 <- Minus
arm_X 16961405..16962009 278..882 99 <- Minus

BO28932.pep Sequence

Translation from 16 to 898

> BO28932.pep
MNKMEENFYNGCTCCHCSCRRSCSCSSLKRCNSAESCRLLIQKSSKYIYD
GVRCSDLRCPYCNEALGQKILLSHSAESTARTPQQTRISDIQFSHSDKGR
KSYSKMKSMSGFEEPKDQVQYKKRESSISTPFSCYREDSPRSSSRVKSTG
KYSCNCFTKEQPRKYVSKTAEEIRRTVRAEIAEMEQKQAMADKNGCDFTF
CKPPQSGRLSSNEETKSKSKDEEIFTESEKLILSKIDWRTTATNDLSNSE
VIYSTIKRLLRVCLNNKIIELGLLDSLHDAIAQFKRDNASFLDH

BO28932.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-PA 288 CG43077-PA 1..288 1..288 1516 100 Plus